Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4F7V8

Protein Details
Accession A0A0C4F7V8    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
96-116DEARLIRHKRHLKRNGIDPVTBasic
NLS Segment(s)
Subcellular Location(s) extr 8, cyto 7, nucl 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018559  DUF2015  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF09435  DUF2015  
Amino Acid Sequences MGFPWLSFPWISFSGVFIFSGLLVFHYRYRILAYLPPRVQARFAQYAPVPDFEAAQLAGFESSEFSINNNLTQDDHRQLDIDEVRRIMLQKNCSFDEARLIRHKRHLKRNGIDPVTGLPTDKKAITSLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.17
4 0.12
5 0.11
6 0.09
7 0.09
8 0.08
9 0.07
10 0.08
11 0.09
12 0.1
13 0.12
14 0.13
15 0.13
16 0.15
17 0.15
18 0.15
19 0.19
20 0.22
21 0.29
22 0.3
23 0.33
24 0.33
25 0.32
26 0.33
27 0.3
28 0.32
29 0.28
30 0.27
31 0.27
32 0.26
33 0.3
34 0.29
35 0.27
36 0.22
37 0.16
38 0.16
39 0.13
40 0.13
41 0.08
42 0.07
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.03
49 0.04
50 0.05
51 0.05
52 0.05
53 0.08
54 0.08
55 0.09
56 0.09
57 0.09
58 0.1
59 0.11
60 0.14
61 0.15
62 0.16
63 0.15
64 0.15
65 0.15
66 0.19
67 0.21
68 0.2
69 0.19
70 0.18
71 0.18
72 0.19
73 0.19
74 0.2
75 0.21
76 0.26
77 0.28
78 0.32
79 0.33
80 0.35
81 0.35
82 0.3
83 0.35
84 0.29
85 0.31
86 0.37
87 0.39
88 0.41
89 0.5
90 0.59
91 0.59
92 0.68
93 0.72
94 0.73
95 0.76
96 0.82
97 0.83
98 0.76
99 0.67
100 0.57
101 0.51
102 0.44
103 0.37
104 0.29
105 0.2
106 0.2
107 0.23
108 0.22
109 0.2