Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4JNH8

Protein Details
Accession A0A1G4JNH8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSAPRETKKRTARRKKDPNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
6-23ETKKRTARRKKDPNAPKR
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MSAPRETKKRTARRKKDPNAPKRALSAYMFFANENRDIVRAENPGISFGQVGRILGEKWKGLNEEEKQPYEAKAEADKKRYESEKELYNATKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.93
4 0.93
5 0.92
6 0.91
7 0.85
8 0.77
9 0.7
10 0.63
11 0.55
12 0.46
13 0.38
14 0.31
15 0.28
16 0.25
17 0.21
18 0.2
19 0.18
20 0.17
21 0.15
22 0.12
23 0.11
24 0.11
25 0.12
26 0.13
27 0.13
28 0.13
29 0.13
30 0.13
31 0.13
32 0.13
33 0.12
34 0.09
35 0.08
36 0.1
37 0.08
38 0.08
39 0.08
40 0.08
41 0.08
42 0.11
43 0.12
44 0.1
45 0.1
46 0.12
47 0.13
48 0.14
49 0.21
50 0.22
51 0.3
52 0.34
53 0.35
54 0.35
55 0.34
56 0.34
57 0.29
58 0.27
59 0.2
60 0.24
61 0.32
62 0.36
63 0.41
64 0.43
65 0.44
66 0.5
67 0.53
68 0.5
69 0.48
70 0.48
71 0.5
72 0.49
73 0.51