Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4J4P7

Protein Details
Accession A0A1G4J4P7    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
175-201TDQNQAKSALPRKRPKRNSAEGNPFSTHydrophilic
NLS Segment(s)
PositionSequence
186-190RKRPK
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031783  Csm2  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005634  C:nucleus  
GO:0097196  C:Shu complex  
GO:0000725  P:recombinational repair  
Pfam View protein in Pfam  
PF16834  CSM2  
Amino Acid Sequences MTTTTSSALGDLDILSVYFNDSADTLGEIIVSLMAPQDQLAARTVYFIDAMDRFPLNKFREKLPPRTEPEIYDRIRVIVCLDMQELATLVQKLVQTAQRDRIASQVGSGAHQGRVIIILNGLEIMFRNSSLRSAVQAHAVLKDCMLRLRTAGNASSEFRTLVVFPADQNSQISATDQNQAKSALPRKRPKRNSAEGNPFSTYLCKYYADCIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.07
5 0.07
6 0.07
7 0.07
8 0.07
9 0.08
10 0.08
11 0.09
12 0.07
13 0.07
14 0.06
15 0.06
16 0.06
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.07
25 0.07
26 0.08
27 0.1
28 0.11
29 0.1
30 0.11
31 0.12
32 0.1
33 0.1
34 0.09
35 0.1
36 0.1
37 0.11
38 0.12
39 0.12
40 0.12
41 0.14
42 0.22
43 0.23
44 0.3
45 0.31
46 0.33
47 0.44
48 0.48
49 0.56
50 0.56
51 0.61
52 0.59
53 0.63
54 0.61
55 0.53
56 0.54
57 0.52
58 0.46
59 0.4
60 0.33
61 0.29
62 0.27
63 0.24
64 0.19
65 0.12
66 0.11
67 0.09
68 0.1
69 0.08
70 0.08
71 0.08
72 0.07
73 0.06
74 0.07
75 0.06
76 0.05
77 0.08
78 0.08
79 0.08
80 0.1
81 0.13
82 0.15
83 0.17
84 0.23
85 0.24
86 0.25
87 0.25
88 0.25
89 0.23
90 0.2
91 0.18
92 0.15
93 0.12
94 0.12
95 0.13
96 0.11
97 0.09
98 0.1
99 0.09
100 0.07
101 0.07
102 0.07
103 0.06
104 0.05
105 0.05
106 0.04
107 0.04
108 0.04
109 0.03
110 0.03
111 0.05
112 0.05
113 0.05
114 0.06
115 0.06
116 0.07
117 0.09
118 0.09
119 0.1
120 0.13
121 0.13
122 0.15
123 0.17
124 0.17
125 0.18
126 0.2
127 0.17
128 0.15
129 0.16
130 0.13
131 0.14
132 0.15
133 0.12
134 0.12
135 0.13
136 0.15
137 0.16
138 0.17
139 0.16
140 0.18
141 0.2
142 0.2
143 0.19
144 0.17
145 0.15
146 0.15
147 0.13
148 0.12
149 0.12
150 0.1
151 0.1
152 0.14
153 0.14
154 0.14
155 0.14
156 0.14
157 0.13
158 0.13
159 0.14
160 0.13
161 0.15
162 0.21
163 0.23
164 0.22
165 0.23
166 0.25
167 0.26
168 0.3
169 0.38
170 0.39
171 0.47
172 0.57
173 0.65
174 0.75
175 0.83
176 0.85
177 0.86
178 0.88
179 0.88
180 0.88
181 0.89
182 0.83
183 0.78
184 0.7
185 0.6
186 0.51
187 0.43
188 0.35
189 0.26
190 0.24
191 0.21
192 0.2