Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4IPA7

Protein Details
Accession A0A1G4IPA7    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
264-283LNKYSVKKSKFKNQDASRRSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR019622  Rrn9_dom  
Pfam View protein in Pfam  
PF10680  RRN9  
Amino Acid Sequences MSQDCNNDEDAGNSASVKASHRLLKDANEILDSLEQSHRNDLALHLYSSHLLKSLLRRANKKRGLLEVDLFIKTQIKDNWTSWPNPGTVIDPQTDSIYEDVEVTIPENRTLKAGEVSMAGLDRASELLKAEMNAVWQRSLAKSASSRGLTVDINKMEMPQFVFNGVIGRLDTFFDGLHRTMAKEKKLELSQEKNTGALKINQENGTVKNVKMNRAIRLDYRDVIQRGTQMGVDMSHVYMKTLELFSDIPYRFRKSAFKLPLAELNKYSVKKSKFKNQDASRRSVNKDFLSVEKLVRASGINPALRQTLREFHTIQTKYLLDEKMFLTVKYQRNLSGLEEDEEYNMDDCKVVLPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.15
4 0.16
5 0.17
6 0.21
7 0.27
8 0.28
9 0.33
10 0.35
11 0.39
12 0.43
13 0.43
14 0.39
15 0.34
16 0.32
17 0.28
18 0.28
19 0.23
20 0.19
21 0.2
22 0.21
23 0.22
24 0.26
25 0.24
26 0.23
27 0.23
28 0.21
29 0.23
30 0.23
31 0.21
32 0.18
33 0.18
34 0.2
35 0.2
36 0.19
37 0.13
38 0.12
39 0.15
40 0.21
41 0.3
42 0.35
43 0.41
44 0.51
45 0.59
46 0.69
47 0.73
48 0.72
49 0.68
50 0.69
51 0.68
52 0.63
53 0.56
54 0.5
55 0.45
56 0.39
57 0.35
58 0.27
59 0.25
60 0.21
61 0.24
62 0.22
63 0.23
64 0.27
65 0.28
66 0.37
67 0.36
68 0.38
69 0.35
70 0.34
71 0.31
72 0.28
73 0.28
74 0.22
75 0.22
76 0.23
77 0.2
78 0.18
79 0.19
80 0.18
81 0.17
82 0.15
83 0.12
84 0.1
85 0.09
86 0.08
87 0.08
88 0.07
89 0.07
90 0.07
91 0.1
92 0.1
93 0.12
94 0.13
95 0.13
96 0.14
97 0.15
98 0.15
99 0.13
100 0.13
101 0.11
102 0.11
103 0.11
104 0.1
105 0.09
106 0.08
107 0.06
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.06
115 0.07
116 0.07
117 0.08
118 0.08
119 0.1
120 0.12
121 0.12
122 0.11
123 0.11
124 0.12
125 0.12
126 0.14
127 0.12
128 0.12
129 0.13
130 0.16
131 0.2
132 0.19
133 0.19
134 0.17
135 0.19
136 0.17
137 0.17
138 0.19
139 0.15
140 0.15
141 0.15
142 0.15
143 0.13
144 0.14
145 0.13
146 0.1
147 0.1
148 0.09
149 0.09
150 0.08
151 0.09
152 0.08
153 0.06
154 0.05
155 0.06
156 0.06
157 0.06
158 0.06
159 0.05
160 0.05
161 0.05
162 0.07
163 0.07
164 0.08
165 0.08
166 0.09
167 0.15
168 0.19
169 0.21
170 0.21
171 0.22
172 0.26
173 0.27
174 0.32
175 0.32
176 0.34
177 0.36
178 0.39
179 0.38
180 0.34
181 0.33
182 0.29
183 0.25
184 0.23
185 0.22
186 0.2
187 0.24
188 0.23
189 0.24
190 0.24
191 0.23
192 0.24
193 0.22
194 0.19
195 0.22
196 0.23
197 0.25
198 0.32
199 0.33
200 0.33
201 0.35
202 0.37
203 0.34
204 0.38
205 0.38
206 0.3
207 0.29
208 0.3
209 0.26
210 0.26
211 0.23
212 0.19
213 0.18
214 0.18
215 0.16
216 0.11
217 0.1
218 0.09
219 0.1
220 0.08
221 0.07
222 0.09
223 0.08
224 0.08
225 0.08
226 0.08
227 0.09
228 0.09
229 0.09
230 0.09
231 0.1
232 0.11
233 0.18
234 0.19
235 0.2
236 0.24
237 0.28
238 0.28
239 0.3
240 0.35
241 0.34
242 0.44
243 0.47
244 0.49
245 0.48
246 0.49
247 0.55
248 0.51
249 0.47
250 0.37
251 0.35
252 0.35
253 0.33
254 0.34
255 0.33
256 0.36
257 0.42
258 0.48
259 0.54
260 0.59
261 0.66
262 0.74
263 0.76
264 0.81
265 0.79
266 0.78
267 0.77
268 0.73
269 0.69
270 0.65
271 0.62
272 0.52
273 0.51
274 0.47
275 0.41
276 0.39
277 0.35
278 0.29
279 0.27
280 0.25
281 0.21
282 0.2
283 0.17
284 0.13
285 0.19
286 0.24
287 0.22
288 0.23
289 0.25
290 0.28
291 0.28
292 0.29
293 0.26
294 0.28
295 0.29
296 0.33
297 0.32
298 0.31
299 0.41
300 0.4
301 0.38
302 0.36
303 0.33
304 0.31
305 0.36
306 0.35
307 0.26
308 0.27
309 0.27
310 0.29
311 0.29
312 0.26
313 0.25
314 0.31
315 0.38
316 0.39
317 0.41
318 0.36
319 0.37
320 0.4
321 0.38
322 0.36
323 0.31
324 0.28
325 0.28
326 0.26
327 0.24
328 0.23
329 0.21
330 0.15
331 0.14
332 0.12
333 0.1
334 0.1