Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4EW64

Protein Details
Accession A0A0C4EW64    Localization Confidence High Confidence Score 19.5
NoLS Segment(s)
PositionSequenceProtein Nature
24-44LPSRPVTKRGREKAGEKNPPEBasic
337-356TPPSPSPAPGKKKTAKPAAPHydrophilic
NLS Segment(s)
PositionSequence
137-145KKRAGKEKA
177-197AKKSRPARGKAAKKTAKAAVR
222-245KPRGAKKPVVAVPRARRKPTTKAR
312-353GAKKGRRPAAPAPPPRSPSPSGSILTPPSPSPAPGKKKTAKP
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MEHRIEELEELVKILEDERDMSELPSRPVTKRGREKAGEKNPPEEQEEWGEERDGDEDVDNPARLITSDSWVSIGAVAKKLSRGRQAKGAKTASTTRDTGVGPSSKSATPVIQPPEEEVVGQPEVEASEQPAHTSPKKRAGKEKAKQPSSEDEDVGSPVATDRREPSVEKNVDEQPAKKSRPARGKAAKKTAKAAVRKNNDEDTHQEVEEEESNEHAAVVAKPRGAKKPVVAVPRARRKPTTKARVAEPPGEKDPADESDLIVTTNEEEEDGDHGDSAILAIADQEENDDEEEEDASRAGEEEEEVESAAPGAKKGRRPAAPAPPPRSPSPSGSILTPPSPSPAPGKKKTAKPAAPDSPQPVSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.11
5 0.12
6 0.15
7 0.15
8 0.16
9 0.22
10 0.23
11 0.25
12 0.3
13 0.32
14 0.32
15 0.41
16 0.48
17 0.52
18 0.6
19 0.66
20 0.68
21 0.72
22 0.77
23 0.78
24 0.81
25 0.81
26 0.73
27 0.7
28 0.66
29 0.62
30 0.6
31 0.5
32 0.42
33 0.38
34 0.39
35 0.35
36 0.31
37 0.28
38 0.24
39 0.23
40 0.21
41 0.15
42 0.12
43 0.1
44 0.09
45 0.12
46 0.15
47 0.14
48 0.13
49 0.12
50 0.12
51 0.12
52 0.15
53 0.12
54 0.14
55 0.15
56 0.15
57 0.15
58 0.15
59 0.15
60 0.13
61 0.15
62 0.14
63 0.16
64 0.16
65 0.17
66 0.22
67 0.26
68 0.29
69 0.36
70 0.39
71 0.4
72 0.49
73 0.56
74 0.57
75 0.61
76 0.59
77 0.51
78 0.49
79 0.52
80 0.46
81 0.42
82 0.37
83 0.29
84 0.28
85 0.27
86 0.25
87 0.24
88 0.22
89 0.19
90 0.19
91 0.22
92 0.18
93 0.2
94 0.2
95 0.16
96 0.16
97 0.22
98 0.25
99 0.23
100 0.23
101 0.23
102 0.25
103 0.23
104 0.21
105 0.15
106 0.14
107 0.13
108 0.13
109 0.1
110 0.08
111 0.08
112 0.08
113 0.08
114 0.06
115 0.09
116 0.09
117 0.1
118 0.12
119 0.16
120 0.21
121 0.26
122 0.29
123 0.37
124 0.44
125 0.47
126 0.55
127 0.62
128 0.68
129 0.7
130 0.75
131 0.75
132 0.72
133 0.69
134 0.62
135 0.6
136 0.56
137 0.5
138 0.41
139 0.31
140 0.28
141 0.27
142 0.23
143 0.15
144 0.08
145 0.06
146 0.08
147 0.08
148 0.08
149 0.09
150 0.13
151 0.14
152 0.16
153 0.2
154 0.28
155 0.29
156 0.29
157 0.31
158 0.31
159 0.33
160 0.33
161 0.3
162 0.26
163 0.32
164 0.32
165 0.32
166 0.35
167 0.39
168 0.48
169 0.5
170 0.53
171 0.56
172 0.64
173 0.68
174 0.73
175 0.71
176 0.63
177 0.63
178 0.59
179 0.56
180 0.53
181 0.54
182 0.52
183 0.54
184 0.56
185 0.55
186 0.54
187 0.49
188 0.44
189 0.4
190 0.37
191 0.32
192 0.28
193 0.25
194 0.19
195 0.2
196 0.2
197 0.17
198 0.11
199 0.09
200 0.1
201 0.09
202 0.09
203 0.08
204 0.07
205 0.06
206 0.1
207 0.11
208 0.12
209 0.15
210 0.19
211 0.24
212 0.25
213 0.27
214 0.25
215 0.33
216 0.37
217 0.39
218 0.4
219 0.43
220 0.5
221 0.58
222 0.62
223 0.57
224 0.58
225 0.58
226 0.65
227 0.68
228 0.69
229 0.66
230 0.63
231 0.64
232 0.67
233 0.66
234 0.63
235 0.56
236 0.51
237 0.45
238 0.44
239 0.39
240 0.31
241 0.29
242 0.23
243 0.22
244 0.17
245 0.15
246 0.14
247 0.15
248 0.14
249 0.11
250 0.09
251 0.07
252 0.07
253 0.07
254 0.05
255 0.05
256 0.06
257 0.08
258 0.09
259 0.08
260 0.08
261 0.08
262 0.08
263 0.07
264 0.07
265 0.05
266 0.04
267 0.03
268 0.04
269 0.04
270 0.05
271 0.05
272 0.05
273 0.05
274 0.06
275 0.07
276 0.08
277 0.07
278 0.08
279 0.09
280 0.08
281 0.08
282 0.07
283 0.07
284 0.06
285 0.06
286 0.06
287 0.06
288 0.06
289 0.07
290 0.08
291 0.08
292 0.08
293 0.08
294 0.07
295 0.07
296 0.1
297 0.09
298 0.09
299 0.15
300 0.21
301 0.27
302 0.34
303 0.43
304 0.45
305 0.52
306 0.6
307 0.65
308 0.7
309 0.74
310 0.73
311 0.72
312 0.72
313 0.69
314 0.66
315 0.59
316 0.54
317 0.5
318 0.48
319 0.42
320 0.4
321 0.4
322 0.37
323 0.35
324 0.32
325 0.27
326 0.26
327 0.26
328 0.25
329 0.29
330 0.36
331 0.43
332 0.49
333 0.58
334 0.63
335 0.71
336 0.79
337 0.81
338 0.78
339 0.77
340 0.79
341 0.79
342 0.76
343 0.73
344 0.69