Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4JSI0

Protein Details
Accession A0A1G4JSI0   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
111-134FKYDEKFTSRDKRRKKHFPQGLFGBasic
NLS Segment(s)
PositionSequence
123-125RRK
Subcellular Location(s) cyto 7, extr 5, cyto_nucl 5, cyto_mito 5, nucl 3, mito 3, E.R. 3, golg 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015720  Emp24-like  
IPR009038  GOLD_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016020  C:membrane  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
Pfam View protein in Pfam  
PF01105  EMP24_GP25L  
PROSITE View protein in PROSITE  
PS50866  GOLD  
Amino Acid Sequences MASKLAFWLIWTLATAAPITFELKAGFRECFYLLTPDIDCKISYYFAVQRGDENKLSVNYEIYKPDNRDKAAVVRKGETQGQWSFIGEHKGEYGLCFSSGDEGNKIIDVEFKYDEKFTSRDKRRKKHFPQGLFGQDPLHESLEDSIDDIERHMSVLERKLDHYKARSIRNQQTVMSTGKRIVGFSLYGILLVVVMGVAQCLVLQAFFNEARKYAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.09
4 0.09
5 0.1
6 0.11
7 0.1
8 0.1
9 0.11
10 0.12
11 0.15
12 0.16
13 0.16
14 0.15
15 0.17
16 0.17
17 0.18
18 0.18
19 0.19
20 0.18
21 0.19
22 0.19
23 0.19
24 0.2
25 0.19
26 0.18
27 0.15
28 0.16
29 0.14
30 0.14
31 0.16
32 0.18
33 0.23
34 0.25
35 0.24
36 0.27
37 0.29
38 0.34
39 0.3
40 0.27
41 0.24
42 0.22
43 0.24
44 0.2
45 0.19
46 0.17
47 0.18
48 0.2
49 0.21
50 0.24
51 0.27
52 0.33
53 0.37
54 0.35
55 0.35
56 0.34
57 0.39
58 0.43
59 0.43
60 0.38
61 0.35
62 0.36
63 0.36
64 0.37
65 0.29
66 0.26
67 0.22
68 0.22
69 0.21
70 0.19
71 0.18
72 0.17
73 0.2
74 0.15
75 0.14
76 0.12
77 0.12
78 0.12
79 0.11
80 0.1
81 0.07
82 0.07
83 0.07
84 0.07
85 0.09
86 0.1
87 0.1
88 0.09
89 0.09
90 0.09
91 0.09
92 0.09
93 0.06
94 0.08
95 0.08
96 0.1
97 0.1
98 0.11
99 0.11
100 0.12
101 0.12
102 0.12
103 0.14
104 0.18
105 0.27
106 0.36
107 0.45
108 0.54
109 0.63
110 0.71
111 0.8
112 0.83
113 0.84
114 0.83
115 0.8
116 0.77
117 0.74
118 0.71
119 0.61
120 0.52
121 0.42
122 0.33
123 0.29
124 0.24
125 0.17
126 0.11
127 0.1
128 0.1
129 0.11
130 0.1
131 0.09
132 0.08
133 0.07
134 0.07
135 0.07
136 0.07
137 0.06
138 0.07
139 0.06
140 0.08
141 0.1
142 0.16
143 0.2
144 0.2
145 0.23
146 0.28
147 0.32
148 0.36
149 0.37
150 0.4
151 0.43
152 0.5
153 0.55
154 0.59
155 0.64
156 0.67
157 0.65
158 0.58
159 0.55
160 0.5
161 0.47
162 0.4
163 0.32
164 0.26
165 0.27
166 0.27
167 0.24
168 0.21
169 0.19
170 0.16
171 0.16
172 0.17
173 0.12
174 0.11
175 0.11
176 0.1
177 0.07
178 0.06
179 0.06
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.02
186 0.02
187 0.03
188 0.04
189 0.04
190 0.05
191 0.05
192 0.1
193 0.12
194 0.17
195 0.17