Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4KGT8

Protein Details
Accession A0A1G4KGT8   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
76-101AQDPLKLRRKQLRKTNRENIKQTNFLHydrophilic
NLS Segment(s)
PositionSequence
79-89PLKLRRKQLRK
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSLLRLEMRRLFSKSCKYLAQQASALPNVPSSCPAGTPLNLQIKKAGKEPVALEDSEYPEWLWKVLDDKAQRKKLAQDPLKLRRKQLRKTNRENIKQTNFLSKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.5
3 0.49
4 0.47
5 0.53
6 0.52
7 0.49
8 0.41
9 0.39
10 0.38
11 0.35
12 0.32
13 0.23
14 0.2
15 0.16
16 0.15
17 0.14
18 0.13
19 0.12
20 0.12
21 0.15
22 0.15
23 0.14
24 0.16
25 0.21
26 0.28
27 0.29
28 0.29
29 0.31
30 0.33
31 0.34
32 0.34
33 0.32
34 0.23
35 0.25
36 0.25
37 0.24
38 0.21
39 0.2
40 0.18
41 0.15
42 0.17
43 0.15
44 0.14
45 0.1
46 0.1
47 0.1
48 0.1
49 0.08
50 0.06
51 0.08
52 0.1
53 0.16
54 0.22
55 0.3
56 0.4
57 0.46
58 0.47
59 0.47
60 0.52
61 0.54
62 0.58
63 0.56
64 0.55
65 0.59
66 0.68
67 0.76
68 0.71
69 0.71
70 0.7
71 0.73
72 0.74
73 0.76
74 0.76
75 0.77
76 0.85
77 0.88
78 0.89
79 0.89
80 0.87
81 0.87
82 0.83
83 0.79
84 0.72