Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4JCP6

Protein Details
Accession A0A1G4JCP6    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKKRASNGRNKKGRGHVKPVRCVNCHydrophilic
83-105VVRVRSRENRRIRAPPQRQRFVRHydrophilic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
89-101RENRRIRAPPQRQ
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVKPVRCVNCSKCVPKDKAIKRMAIRNIVEAAAVRDLSEASVYPEYALPKTYNKLQYCVSCAIHGRVVRVRSRENRRIRAPPQRQRFVRDKNISPADAAKKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.76
6 0.81
7 0.82
8 0.78
9 0.7
10 0.69
11 0.63
12 0.63
13 0.61
14 0.58
15 0.57
16 0.6
17 0.61
18 0.63
19 0.68
20 0.66
21 0.7
22 0.67
23 0.66
24 0.61
25 0.64
26 0.61
27 0.58
28 0.51
29 0.43
30 0.4
31 0.33
32 0.29
33 0.21
34 0.17
35 0.1
36 0.09
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.04
43 0.06
44 0.06
45 0.06
46 0.07
47 0.08
48 0.09
49 0.09
50 0.1
51 0.09
52 0.11
53 0.13
54 0.19
55 0.26
56 0.26
57 0.28
58 0.3
59 0.3
60 0.32
61 0.34
62 0.29
63 0.23
64 0.24
65 0.23
66 0.24
67 0.23
68 0.22
69 0.23
70 0.26
71 0.28
72 0.31
73 0.37
74 0.43
75 0.52
76 0.58
77 0.64
78 0.69
79 0.72
80 0.77
81 0.78
82 0.79
83 0.8
84 0.81
85 0.81
86 0.83
87 0.79
88 0.77
89 0.79
90 0.77
91 0.77
92 0.75
93 0.7
94 0.7
95 0.72
96 0.65
97 0.57
98 0.55
99 0.51