Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4MHA6

Protein Details
Accession A0A1G4MHA6    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
88-107MEKAKNKKYKQDDEIRIKGEBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 12.333, cyto 10, cyto_pero 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR014849  EKC/KEOPS_Gon7  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08738  Gon7  
Amino Acid Sequences MAEPFAVYKSPNEQDREFKVDSTSKRYQTTNGQTTGPSAYVVQAGQVDVDKPSDPKKDENGDYTYLSKLRMGLTGLQDDINEFLTEQMEKAKNKKYKQDDEIRIKGEIEKLLDGGDDDDDDENE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.53
4 0.46
5 0.41
6 0.4
7 0.41
8 0.42
9 0.43
10 0.45
11 0.42
12 0.45
13 0.45
14 0.44
15 0.48
16 0.53
17 0.51
18 0.46
19 0.42
20 0.39
21 0.39
22 0.37
23 0.27
24 0.18
25 0.11
26 0.1
27 0.1
28 0.09
29 0.08
30 0.07
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.08
39 0.12
40 0.16
41 0.18
42 0.21
43 0.25
44 0.3
45 0.31
46 0.34
47 0.32
48 0.3
49 0.29
50 0.27
51 0.23
52 0.18
53 0.17
54 0.13
55 0.12
56 0.1
57 0.1
58 0.1
59 0.12
60 0.13
61 0.14
62 0.14
63 0.13
64 0.12
65 0.11
66 0.11
67 0.09
68 0.07
69 0.06
70 0.06
71 0.07
72 0.07
73 0.07
74 0.12
75 0.16
76 0.18
77 0.24
78 0.33
79 0.39
80 0.44
81 0.54
82 0.58
83 0.63
84 0.7
85 0.75
86 0.76
87 0.78
88 0.8
89 0.73
90 0.64
91 0.55
92 0.49
93 0.42
94 0.34
95 0.27
96 0.21
97 0.19
98 0.18
99 0.17
100 0.15
101 0.12
102 0.1
103 0.08
104 0.09