Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4ME82

Protein Details
Accession A0A1G4ME82    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
24-53GNSASRVSKKACPKRKKKDRCYFEKCNSTAHydrophilic
NLS Segment(s)
PositionSequence
36-41PKRKKK
Subcellular Location(s) nucl 20, cyto_nucl 15, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF01428  zf-AN1  
PROSITE View protein in PROSITE  
PS51039  ZF_AN1  
Amino Acid Sequences MSEVTEKLIGENDLNNATNNVAGGNSASRVSKKACPKRKKKDRCYFEKCNSTAVKFIGDCQFCQGHFCSKHRLMESHACQGLKSCKEQMHQRNADKLAAEQTIVPKIQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.15
4 0.14
5 0.13
6 0.12
7 0.09
8 0.07
9 0.06
10 0.06
11 0.06
12 0.07
13 0.08
14 0.09
15 0.1
16 0.12
17 0.16
18 0.22
19 0.32
20 0.42
21 0.51
22 0.61
23 0.71
24 0.8
25 0.88
26 0.92
27 0.93
28 0.93
29 0.92
30 0.92
31 0.9
32 0.88
33 0.85
34 0.83
35 0.72
36 0.67
37 0.59
38 0.49
39 0.42
40 0.33
41 0.26
42 0.17
43 0.19
44 0.19
45 0.18
46 0.17
47 0.18
48 0.18
49 0.16
50 0.18
51 0.17
52 0.19
53 0.23
54 0.25
55 0.3
56 0.33
57 0.38
58 0.38
59 0.39
60 0.36
61 0.42
62 0.45
63 0.43
64 0.43
65 0.38
66 0.35
67 0.38
68 0.4
69 0.33
70 0.33
71 0.3
72 0.31
73 0.37
74 0.47
75 0.52
76 0.56
77 0.61
78 0.63
79 0.66
80 0.64
81 0.61
82 0.52
83 0.45
84 0.38
85 0.3
86 0.26
87 0.2
88 0.21
89 0.24