Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4ENJ5

Protein Details
Accession A0A0C4ENJ5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
201-225TLEPPRRSTAEQRHRRKANKLGSNMHydrophilic
NLS Segment(s)
PositionSequence
213-220RHRRKANK
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002885  Pentatricopeptide_repeat  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF01535  PPR  
PROSITE View protein in PROSITE  
PS51375  PPR  
Amino Acid Sequences MISASLRLGKHDLAHGYLREMQSSGIRPNLVIYSMLTTAYAAYASLSTQIQGRAEGEEDEEERQEDGPEAAYRKSHLGRAAADAEEYLTLTTGPIIQSYAKSARPAKALEMFRELVSSLGAESGIVSSDGKPIDLDIFTMLMDGYRRAQDPVGVMEVWREIFQLATENNQLQDASKQLIGKVISLTKNDGLPAGGTGNNNTLEPPRRSTAEQRHRRKANKLGSNMPAPRRLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.28
4 0.32
5 0.3
6 0.27
7 0.25
8 0.22
9 0.23
10 0.26
11 0.25
12 0.23
13 0.23
14 0.21
15 0.23
16 0.23
17 0.19
18 0.16
19 0.14
20 0.13
21 0.14
22 0.14
23 0.11
24 0.1
25 0.09
26 0.09
27 0.08
28 0.05
29 0.05
30 0.05
31 0.05
32 0.07
33 0.07
34 0.07
35 0.09
36 0.11
37 0.11
38 0.11
39 0.12
40 0.11
41 0.12
42 0.12
43 0.12
44 0.12
45 0.12
46 0.12
47 0.12
48 0.12
49 0.11
50 0.11
51 0.1
52 0.09
53 0.08
54 0.09
55 0.11
56 0.12
57 0.12
58 0.12
59 0.13
60 0.17
61 0.18
62 0.2
63 0.2
64 0.21
65 0.22
66 0.25
67 0.25
68 0.21
69 0.19
70 0.16
71 0.13
72 0.11
73 0.1
74 0.06
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.06
84 0.06
85 0.1
86 0.12
87 0.12
88 0.16
89 0.19
90 0.21
91 0.23
92 0.23
93 0.23
94 0.27
95 0.28
96 0.26
97 0.27
98 0.25
99 0.22
100 0.22
101 0.19
102 0.12
103 0.1
104 0.08
105 0.04
106 0.04
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.06
116 0.07
117 0.07
118 0.06
119 0.07
120 0.08
121 0.07
122 0.07
123 0.05
124 0.06
125 0.05
126 0.06
127 0.05
128 0.04
129 0.05
130 0.05
131 0.06
132 0.08
133 0.09
134 0.09
135 0.1
136 0.11
137 0.12
138 0.13
139 0.13
140 0.12
141 0.11
142 0.11
143 0.11
144 0.1
145 0.09
146 0.08
147 0.06
148 0.06
149 0.06
150 0.09
151 0.09
152 0.11
153 0.13
154 0.13
155 0.14
156 0.14
157 0.14
158 0.12
159 0.13
160 0.12
161 0.12
162 0.13
163 0.13
164 0.13
165 0.17
166 0.17
167 0.16
168 0.17
169 0.21
170 0.21
171 0.22
172 0.25
173 0.23
174 0.23
175 0.22
176 0.2
177 0.15
178 0.13
179 0.13
180 0.11
181 0.12
182 0.12
183 0.13
184 0.15
185 0.16
186 0.15
187 0.15
188 0.19
189 0.24
190 0.27
191 0.31
192 0.32
193 0.34
194 0.39
195 0.48
196 0.54
197 0.58
198 0.65
199 0.7
200 0.77
201 0.83
202 0.86
203 0.85
204 0.84
205 0.84
206 0.83
207 0.79
208 0.77
209 0.74
210 0.76
211 0.74
212 0.69