Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4MAR9

Protein Details
Accession A0A1G4MAR9    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
79-108MNEARKRRGKGAPTKKKEAAKEKGKTKKRKBasic
NLS Segment(s)
PositionSequence
82-108ARKRRGKGAPTKKKEAAKEKGKTKKRK
Subcellular Location(s) mito 18.5, mito_nucl 13, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVPKSRIMKVLQLSAEIFDQKFNPSATRTGGKILSKRLKGSSIASYYGNPDFLKFKHLKTLYPGMQFVDQEEEYRLSMNEARKRRGKGAPTKKKEAAKEKGKTKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.3
3 0.29
4 0.24
5 0.2
6 0.15
7 0.15
8 0.15
9 0.17
10 0.16
11 0.17
12 0.17
13 0.19
14 0.21
15 0.23
16 0.22
17 0.23
18 0.26
19 0.28
20 0.29
21 0.36
22 0.4
23 0.4
24 0.42
25 0.4
26 0.38
27 0.36
28 0.36
29 0.32
30 0.27
31 0.26
32 0.24
33 0.22
34 0.22
35 0.21
36 0.19
37 0.13
38 0.12
39 0.12
40 0.12
41 0.17
42 0.17
43 0.17
44 0.24
45 0.25
46 0.25
47 0.28
48 0.36
49 0.34
50 0.34
51 0.34
52 0.27
53 0.28
54 0.27
55 0.22
56 0.19
57 0.15
58 0.14
59 0.15
60 0.14
61 0.13
62 0.14
63 0.13
64 0.1
65 0.15
66 0.21
67 0.28
68 0.32
69 0.39
70 0.45
71 0.49
72 0.54
73 0.58
74 0.6
75 0.64
76 0.69
77 0.74
78 0.76
79 0.8
80 0.81
81 0.8
82 0.8
83 0.79
84 0.78
85 0.77
86 0.78
87 0.79
88 0.83