Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4M736

Protein Details
Accession A0A1G4M736    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MAKGTPAKKKGGSRKNTPVSTPSKKKVAKKQQDEGLIPHydrophilic
NLS Segment(s)
PositionSequence
6-30PAKKKGGSRKNTPVSTPSKKKVAKK
Subcellular Location(s) nucl 18, mito_nucl 11.833, cyto_nucl 11.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
IPR028364  Ribosomal_L1/biogenesis  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
Pfam View protein in Pfam  
PF00687  Ribosomal_L1  
Amino Acid Sequences MAKGTPAKKKGGSRKNTPVSTPSKKKVAKKQQDEGLIPKSRIVRAVEELRKYTTQAEGEQASNNLLEDDEELSKQVQLIVVNTTSFTGSSKSFKPKVLKVENSIFKPWKEASVTSVKDFKLLVILRDQDVGKASEDALYDQLNESGITVDAVIGAGELKTKYKAFEKRRAFLQEFSLVLADDAVVSALPKLLGGKAYDKVSTTPVPVRTGKKGEFSLTTLANSIKKVYLHSVPVKAPRGTTLSAHLGSLEWFSADEMAHNIEQIATQLIKEFKIRSVFLKTNQSPVLPLYYNQDVLSELASASASAAAASADGKPSHTVQIGDVEVELSNFDRALMEIANPDELDKVFANRVSRAKRTAELDQEPASTKRAKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.81
4 0.75
5 0.72
6 0.72
7 0.73
8 0.73
9 0.68
10 0.69
11 0.72
12 0.78
13 0.8
14 0.82
15 0.82
16 0.82
17 0.85
18 0.82
19 0.83
20 0.78
21 0.73
22 0.7
23 0.65
24 0.56
25 0.5
26 0.47
27 0.4
28 0.41
29 0.38
30 0.33
31 0.35
32 0.44
33 0.47
34 0.48
35 0.48
36 0.48
37 0.46
38 0.43
39 0.38
40 0.33
41 0.29
42 0.26
43 0.28
44 0.26
45 0.26
46 0.26
47 0.25
48 0.2
49 0.18
50 0.16
51 0.12
52 0.09
53 0.08
54 0.08
55 0.1
56 0.1
57 0.1
58 0.11
59 0.11
60 0.11
61 0.11
62 0.11
63 0.1
64 0.1
65 0.11
66 0.12
67 0.13
68 0.12
69 0.13
70 0.12
71 0.11
72 0.1
73 0.1
74 0.09
75 0.11
76 0.14
77 0.2
78 0.28
79 0.31
80 0.37
81 0.43
82 0.47
83 0.55
84 0.6
85 0.6
86 0.58
87 0.64
88 0.64
89 0.6
90 0.61
91 0.54
92 0.45
93 0.44
94 0.38
95 0.33
96 0.3
97 0.27
98 0.25
99 0.31
100 0.33
101 0.31
102 0.35
103 0.31
104 0.3
105 0.29
106 0.24
107 0.22
108 0.21
109 0.19
110 0.18
111 0.2
112 0.19
113 0.22
114 0.22
115 0.16
116 0.17
117 0.16
118 0.13
119 0.12
120 0.12
121 0.11
122 0.11
123 0.11
124 0.11
125 0.1
126 0.09
127 0.09
128 0.09
129 0.07
130 0.07
131 0.06
132 0.06
133 0.05
134 0.05
135 0.05
136 0.04
137 0.04
138 0.04
139 0.03
140 0.03
141 0.03
142 0.03
143 0.04
144 0.04
145 0.05
146 0.07
147 0.08
148 0.1
149 0.17
150 0.26
151 0.33
152 0.43
153 0.49
154 0.5
155 0.56
156 0.61
157 0.56
158 0.49
159 0.45
160 0.38
161 0.31
162 0.28
163 0.23
164 0.15
165 0.13
166 0.11
167 0.07
168 0.03
169 0.03
170 0.03
171 0.02
172 0.02
173 0.02
174 0.03
175 0.03
176 0.03
177 0.03
178 0.04
179 0.05
180 0.06
181 0.08
182 0.11
183 0.12
184 0.13
185 0.13
186 0.14
187 0.16
188 0.16
189 0.16
190 0.17
191 0.18
192 0.22
193 0.26
194 0.28
195 0.29
196 0.33
197 0.33
198 0.33
199 0.32
200 0.3
201 0.27
202 0.26
203 0.24
204 0.2
205 0.18
206 0.16
207 0.16
208 0.15
209 0.14
210 0.13
211 0.12
212 0.12
213 0.13
214 0.15
215 0.17
216 0.21
217 0.25
218 0.27
219 0.28
220 0.34
221 0.37
222 0.34
223 0.32
224 0.29
225 0.28
226 0.26
227 0.24
228 0.22
229 0.21
230 0.21
231 0.21
232 0.18
233 0.15
234 0.14
235 0.14
236 0.1
237 0.05
238 0.05
239 0.05
240 0.06
241 0.06
242 0.06
243 0.06
244 0.08
245 0.08
246 0.08
247 0.08
248 0.07
249 0.07
250 0.07
251 0.08
252 0.06
253 0.06
254 0.09
255 0.11
256 0.12
257 0.14
258 0.15
259 0.17
260 0.22
261 0.23
262 0.23
263 0.3
264 0.33
265 0.36
266 0.46
267 0.43
268 0.45
269 0.45
270 0.42
271 0.35
272 0.32
273 0.32
274 0.22
275 0.21
276 0.2
277 0.21
278 0.22
279 0.21
280 0.2
281 0.16
282 0.15
283 0.15
284 0.1
285 0.08
286 0.07
287 0.07
288 0.06
289 0.06
290 0.06
291 0.05
292 0.04
293 0.04
294 0.04
295 0.04
296 0.05
297 0.05
298 0.08
299 0.08
300 0.1
301 0.12
302 0.14
303 0.17
304 0.18
305 0.18
306 0.17
307 0.22
308 0.21
309 0.19
310 0.18
311 0.15
312 0.13
313 0.12
314 0.12
315 0.08
316 0.08
317 0.07
318 0.07
319 0.07
320 0.07
321 0.09
322 0.09
323 0.09
324 0.11
325 0.12
326 0.13
327 0.13
328 0.13
329 0.13
330 0.12
331 0.15
332 0.13
333 0.15
334 0.17
335 0.2
336 0.23
337 0.27
338 0.35
339 0.39
340 0.44
341 0.47
342 0.48
343 0.51
344 0.54
345 0.56
346 0.57
347 0.55
348 0.54
349 0.51
350 0.48
351 0.47
352 0.42
353 0.39