Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4MAW2

Protein Details
Accession A0A1G4MAW2   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
173-193ILCKRCKARFSGPRRFTNMKKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 12.833, nucl 9, mito_nucl 5.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR013895  Rsc14  
Gene Ontology GO:0016586  C:RSC-type complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08586  Rsc14  
Amino Acid Sequences MAEYKLGYYDTIAGLSALECSQKVSLTEKQLEELVAVDAEERQKRDNIDESLQVKDKKRIPIHGYLGKIDTTAAANANHDLKHTLLGGHVPRAQLEILSSTDFAHYFHKVLDCEKALEVYDHFINQNQSRGGTHGTPTPPASVTPSTPIPFGDVQIQDMHRKPKESDGVKKVILCKRCKARFSGPRRFTNMKKHMCMRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.07
5 0.08
6 0.07
7 0.09
8 0.1
9 0.11
10 0.12
11 0.17
12 0.22
13 0.28
14 0.34
15 0.32
16 0.33
17 0.33
18 0.31
19 0.26
20 0.21
21 0.15
22 0.09
23 0.08
24 0.07
25 0.08
26 0.13
27 0.16
28 0.16
29 0.17
30 0.2
31 0.22
32 0.26
33 0.3
34 0.3
35 0.3
36 0.35
37 0.35
38 0.36
39 0.4
40 0.4
41 0.37
42 0.4
43 0.42
44 0.45
45 0.47
46 0.51
47 0.51
48 0.55
49 0.6
50 0.58
51 0.54
52 0.46
53 0.44
54 0.35
55 0.3
56 0.21
57 0.14
58 0.1
59 0.09
60 0.09
61 0.08
62 0.08
63 0.1
64 0.11
65 0.11
66 0.1
67 0.11
68 0.09
69 0.1
70 0.1
71 0.08
72 0.07
73 0.11
74 0.11
75 0.13
76 0.14
77 0.13
78 0.13
79 0.14
80 0.13
81 0.1
82 0.09
83 0.08
84 0.07
85 0.08
86 0.08
87 0.07
88 0.08
89 0.08
90 0.08
91 0.09
92 0.09
93 0.09
94 0.09
95 0.11
96 0.11
97 0.12
98 0.15
99 0.13
100 0.14
101 0.13
102 0.13
103 0.11
104 0.12
105 0.11
106 0.1
107 0.1
108 0.09
109 0.09
110 0.11
111 0.14
112 0.15
113 0.18
114 0.16
115 0.16
116 0.16
117 0.18
118 0.18
119 0.16
120 0.16
121 0.18
122 0.18
123 0.2
124 0.2
125 0.2
126 0.18
127 0.17
128 0.2
129 0.17
130 0.17
131 0.19
132 0.21
133 0.21
134 0.21
135 0.2
136 0.19
137 0.18
138 0.18
139 0.2
140 0.17
141 0.17
142 0.21
143 0.23
144 0.24
145 0.28
146 0.35
147 0.32
148 0.34
149 0.35
150 0.4
151 0.47
152 0.5
153 0.56
154 0.55
155 0.58
156 0.57
157 0.59
158 0.58
159 0.56
160 0.56
161 0.51
162 0.54
163 0.59
164 0.65
165 0.65
166 0.64
167 0.69
168 0.71
169 0.76
170 0.78
171 0.76
172 0.76
173 0.81
174 0.81
175 0.77
176 0.78
177 0.78
178 0.76
179 0.76