Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4MF99

Protein Details
Accession A0A1G4MF99    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
93-113AYRECKKQWLQARRKDRSQWEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12.333, cyto 5, mito 4, cyto_pero 3.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSDNTPKKDSIPENVDPQLQTDKQKVNFTPESTDVNSFKYYPDNPESILNKYRFAAKDASRFYDPCQESSKMSMKCLELNNYDKEMCKEYFDAYRECKKQWLQARRKDRSQWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.4
4 0.39
5 0.36
6 0.32
7 0.32
8 0.32
9 0.36
10 0.38
11 0.44
12 0.43
13 0.44
14 0.45
15 0.43
16 0.42
17 0.38
18 0.38
19 0.33
20 0.36
21 0.29
22 0.27
23 0.26
24 0.22
25 0.2
26 0.2
27 0.19
28 0.2
29 0.23
30 0.21
31 0.21
32 0.27
33 0.28
34 0.28
35 0.33
36 0.29
37 0.26
38 0.26
39 0.3
40 0.24
41 0.25
42 0.26
43 0.23
44 0.29
45 0.3
46 0.33
47 0.3
48 0.3
49 0.29
50 0.33
51 0.31
52 0.26
53 0.29
54 0.26
55 0.26
56 0.3
57 0.36
58 0.28
59 0.28
60 0.29
61 0.26
62 0.29
63 0.31
64 0.3
65 0.27
66 0.31
67 0.33
68 0.32
69 0.32
70 0.29
71 0.28
72 0.28
73 0.24
74 0.23
75 0.21
76 0.21
77 0.26
78 0.28
79 0.3
80 0.32
81 0.41
82 0.41
83 0.41
84 0.46
85 0.44
86 0.5
87 0.56
88 0.61
89 0.62
90 0.69
91 0.78
92 0.8
93 0.84