Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4MEY9

Protein Details
Accession A0A1G4MEY9    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
4-28DEISQKLKKLKRRGVDLRVKNRKETBasic
NLS Segment(s)
PositionSequence
10-26LKKLKRRGVDLRVKNRK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013260  mRNA_splic_SYF2  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF08231  SYF2  
Amino Acid Sequences MDLDEISQKLKKLKRRGVDLRVKNRKETVKEDNETARGKKPLIYSMKDDEEVHEQKDGDERDKLLQYTMKDYERWENKQNREGLRSSEGANLRDLAKLTYDKEIRNITKDGPISSGKVTKKIEINSKGKIVLKDEDKLIDKLKDSLDKTADIRYANIRKKIEKRNGTGAGEAFINNKNRQFNEKLTRESKRLQND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.72
3 0.79
4 0.81
5 0.85
6 0.86
7 0.87
8 0.89
9 0.83
10 0.78
11 0.75
12 0.73
13 0.68
14 0.65
15 0.64
16 0.63
17 0.63
18 0.62
19 0.59
20 0.56
21 0.54
22 0.5
23 0.45
24 0.38
25 0.36
26 0.36
27 0.34
28 0.37
29 0.39
30 0.4
31 0.4
32 0.43
33 0.45
34 0.42
35 0.4
36 0.34
37 0.35
38 0.33
39 0.29
40 0.25
41 0.22
42 0.21
43 0.26
44 0.26
45 0.2
46 0.2
47 0.21
48 0.22
49 0.24
50 0.24
51 0.2
52 0.21
53 0.2
54 0.23
55 0.26
56 0.23
57 0.22
58 0.24
59 0.31
60 0.34
61 0.38
62 0.41
63 0.46
64 0.49
65 0.54
66 0.58
67 0.52
68 0.49
69 0.46
70 0.4
71 0.35
72 0.32
73 0.27
74 0.27
75 0.26
76 0.23
77 0.22
78 0.19
79 0.17
80 0.16
81 0.15
82 0.1
83 0.09
84 0.1
85 0.11
86 0.15
87 0.17
88 0.16
89 0.2
90 0.25
91 0.24
92 0.26
93 0.27
94 0.22
95 0.25
96 0.25
97 0.22
98 0.2
99 0.2
100 0.18
101 0.19
102 0.24
103 0.2
104 0.26
105 0.26
106 0.27
107 0.3
108 0.33
109 0.4
110 0.42
111 0.45
112 0.42
113 0.43
114 0.43
115 0.42
116 0.39
117 0.34
118 0.3
119 0.3
120 0.29
121 0.28
122 0.28
123 0.27
124 0.28
125 0.27
126 0.24
127 0.22
128 0.22
129 0.24
130 0.27
131 0.26
132 0.29
133 0.28
134 0.28
135 0.29
136 0.3
137 0.29
138 0.23
139 0.24
140 0.28
141 0.35
142 0.39
143 0.45
144 0.46
145 0.51
146 0.6
147 0.69
148 0.71
149 0.71
150 0.7
151 0.72
152 0.75
153 0.69
154 0.63
155 0.53
156 0.43
157 0.35
158 0.3
159 0.22
160 0.21
161 0.24
162 0.24
163 0.29
164 0.34
165 0.36
166 0.42
167 0.45
168 0.5
169 0.55
170 0.58
171 0.61
172 0.64
173 0.67
174 0.66
175 0.69