Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4MEI9

Protein Details
Accession A0A1G4MEI9   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
105-126DVVKEHKSLKKKDRWSTTKLFFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13, nucl 12.5, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034455  CNL1  
Gene Ontology GO:0031083  C:BLOC-1 complex  
Amino Acid Sequences MSDEPENVASEEEPCDPFKIDRLTVHYDYLLYKIQDYVSSIHLHTTEICKRQNELVTKEVIEGIIDENIAELQKLLVQCEELESSFDMLDQIDVIVQTFKQRIEDVVKEHKSLKKKDRWSTTKLFFPGPSQSSFADT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.18
5 0.23
6 0.25
7 0.25
8 0.27
9 0.32
10 0.37
11 0.37
12 0.38
13 0.32
14 0.28
15 0.27
16 0.26
17 0.23
18 0.16
19 0.15
20 0.14
21 0.14
22 0.14
23 0.15
24 0.14
25 0.13
26 0.14
27 0.14
28 0.14
29 0.14
30 0.14
31 0.13
32 0.17
33 0.21
34 0.24
35 0.27
36 0.27
37 0.29
38 0.32
39 0.37
40 0.36
41 0.34
42 0.32
43 0.3
44 0.29
45 0.28
46 0.23
47 0.17
48 0.12
49 0.08
50 0.07
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.07
67 0.08
68 0.06
69 0.07
70 0.07
71 0.08
72 0.07
73 0.08
74 0.06
75 0.06
76 0.05
77 0.04
78 0.04
79 0.03
80 0.04
81 0.04
82 0.04
83 0.04
84 0.07
85 0.09
86 0.09
87 0.11
88 0.12
89 0.14
90 0.2
91 0.23
92 0.26
93 0.35
94 0.37
95 0.37
96 0.42
97 0.45
98 0.47
99 0.53
100 0.58
101 0.58
102 0.66
103 0.74
104 0.79
105 0.8
106 0.8
107 0.8
108 0.76
109 0.75
110 0.68
111 0.62
112 0.52
113 0.49
114 0.5
115 0.43
116 0.4
117 0.34