Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4MGF5

Protein Details
Accession A0A1G4MGF5    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MDPYSLKRDNRKKFFDKEKLKRKHATPSDRKYRVBasic
NLS Segment(s)
PositionSequence
10-26NRKKFFDKEKLKRKHAT
Subcellular Location(s) nucl 24, mito 1, cyto 1, vacu 1, cyto_mito 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR035303  DUF5364  
Pfam View protein in Pfam  
PF17322  DUF5364  
Amino Acid Sequences MDPYSLKRDNRKKFFDKEKLKRKHATPSDRKYRVLNKAENPQEEELKPELQPNDYRYHEDITMAHATEDFSTQEVNRKLKQILKDRKDSIGEPKEEPITKRNLESMDVDKLNSLLGRAAPQKRQVTQPDEKHNERLEIKDNTAKPIVQSHVPEDLEDDQDFLDGIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.86
4 0.86
5 0.88
6 0.88
7 0.88
8 0.87
9 0.8
10 0.8
11 0.79
12 0.8
13 0.8
14 0.8
15 0.83
16 0.79
17 0.77
18 0.73
19 0.72
20 0.71
21 0.68
22 0.66
23 0.61
24 0.66
25 0.7
26 0.65
27 0.61
28 0.53
29 0.49
30 0.41
31 0.39
32 0.31
33 0.26
34 0.24
35 0.24
36 0.22
37 0.21
38 0.25
39 0.24
40 0.28
41 0.28
42 0.31
43 0.29
44 0.3
45 0.27
46 0.25
47 0.22
48 0.2
49 0.19
50 0.16
51 0.14
52 0.11
53 0.11
54 0.11
55 0.11
56 0.07
57 0.06
58 0.07
59 0.07
60 0.13
61 0.17
62 0.2
63 0.21
64 0.23
65 0.25
66 0.28
67 0.36
68 0.4
69 0.46
70 0.48
71 0.53
72 0.52
73 0.53
74 0.51
75 0.45
76 0.44
77 0.4
78 0.38
79 0.32
80 0.32
81 0.32
82 0.31
83 0.32
84 0.26
85 0.25
86 0.24
87 0.24
88 0.25
89 0.23
90 0.23
91 0.24
92 0.24
93 0.23
94 0.23
95 0.22
96 0.19
97 0.18
98 0.16
99 0.13
100 0.11
101 0.06
102 0.06
103 0.1
104 0.17
105 0.21
106 0.24
107 0.32
108 0.36
109 0.38
110 0.45
111 0.48
112 0.49
113 0.55
114 0.59
115 0.62
116 0.65
117 0.66
118 0.65
119 0.61
120 0.59
121 0.52
122 0.47
123 0.44
124 0.4
125 0.42
126 0.43
127 0.42
128 0.4
129 0.4
130 0.37
131 0.31
132 0.33
133 0.32
134 0.29
135 0.3
136 0.29
137 0.34
138 0.34
139 0.32
140 0.3
141 0.29
142 0.27
143 0.25
144 0.22
145 0.15
146 0.15