Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4MJU0

Protein Details
Accession A0A1G4MJU0    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MSLQASNKRTRRSKKRRTADISDSDSSHydrophilic
NLS Segment(s)
PositionSequence
8-17KRTRRSKKRR
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MSLQASNKRTRRSKKRRTADISDSDSSSSSSSSSASESEMEADAKENEDNIELSDIEMSEEDDAQKVTSERLDDETRNRLNQIPLTNTELSKRAGNNVNSIDLKKVQHDIEEAKEKVSLVKDGNELKNAYLNVLFNHYGEDVNSLRKAPDFTAKSLVLLANVLKDGANMFDVDSLKTIVEPKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.92
3 0.93
4 0.92
5 0.9
6 0.88
7 0.85
8 0.81
9 0.72
10 0.63
11 0.52
12 0.44
13 0.36
14 0.27
15 0.18
16 0.11
17 0.09
18 0.09
19 0.09
20 0.1
21 0.09
22 0.1
23 0.11
24 0.1
25 0.11
26 0.12
27 0.11
28 0.1
29 0.11
30 0.1
31 0.11
32 0.1
33 0.09
34 0.09
35 0.09
36 0.09
37 0.08
38 0.09
39 0.08
40 0.08
41 0.08
42 0.07
43 0.07
44 0.06
45 0.06
46 0.05
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.09
58 0.13
59 0.16
60 0.17
61 0.2
62 0.26
63 0.27
64 0.27
65 0.27
66 0.25
67 0.24
68 0.26
69 0.26
70 0.21
71 0.21
72 0.25
73 0.25
74 0.23
75 0.22
76 0.21
77 0.19
78 0.19
79 0.17
80 0.16
81 0.21
82 0.22
83 0.24
84 0.23
85 0.25
86 0.24
87 0.24
88 0.22
89 0.18
90 0.18
91 0.16
92 0.18
93 0.15
94 0.15
95 0.16
96 0.17
97 0.19
98 0.25
99 0.24
100 0.22
101 0.22
102 0.21
103 0.21
104 0.2
105 0.19
106 0.13
107 0.15
108 0.19
109 0.24
110 0.26
111 0.26
112 0.26
113 0.23
114 0.25
115 0.23
116 0.2
117 0.16
118 0.15
119 0.13
120 0.16
121 0.17
122 0.13
123 0.14
124 0.14
125 0.13
126 0.12
127 0.15
128 0.12
129 0.15
130 0.16
131 0.15
132 0.15
133 0.16
134 0.18
135 0.16
136 0.25
137 0.25
138 0.27
139 0.32
140 0.32
141 0.31
142 0.31
143 0.29
144 0.2
145 0.18
146 0.15
147 0.11
148 0.11
149 0.1
150 0.08
151 0.08
152 0.08
153 0.08
154 0.09
155 0.07
156 0.08
157 0.11
158 0.12
159 0.13
160 0.14
161 0.13
162 0.13
163 0.14