Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4FCX5

Protein Details
Accession A0A0C4FCX5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
27-52ADNLRLRRQRNRASRRLRREREREEABasic
NLS Segment(s)
PositionSequence
29-77NLRLRRQRNRASRRLRREREREEAARNRREMNRERDEEERNRRDRERAR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MIDLSNLRPGDRDAIARSEFERQVRRADNLRLRRQRNRASRRLRREREREEAARNRREMNRERDEEERNRRDRERARERIDDCE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.25
4 0.25
5 0.27
6 0.28
7 0.3
8 0.34
9 0.3
10 0.36
11 0.38
12 0.41
13 0.4
14 0.46
15 0.5
16 0.53
17 0.62
18 0.64
19 0.68
20 0.72
21 0.76
22 0.77
23 0.78
24 0.78
25 0.78
26 0.8
27 0.83
28 0.85
29 0.87
30 0.86
31 0.85
32 0.85
33 0.82
34 0.79
35 0.76
36 0.7
37 0.68
38 0.68
39 0.67
40 0.64
41 0.58
42 0.56
43 0.53
44 0.56
45 0.55
46 0.55
47 0.56
48 0.54
49 0.55
50 0.55
51 0.59
52 0.6
53 0.63
54 0.63
55 0.6
56 0.63
57 0.63
58 0.67
59 0.69
60 0.7
61 0.7
62 0.71
63 0.73
64 0.76