Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4F9U4

Protein Details
Accession A0A0C4F9U4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
130-177IKVNKETEKKKPYKIPKIDRSNPKALGLKPYERKPKSGSNKWKETFKMHydrophilic
NLS Segment(s)
PositionSequence
18-23KRGRGR
128-170KDIKVNKETEKKKPYKIPKIDRSNPKALGLKPYERKPKSGSNK
Subcellular Location(s) nucl 15, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MVGTRSGKDHASNPPPTKRGRGRGTAQGGRARSHNQGTPSSILTSLGPSPQQSVGGRHSDIQSDKGRLPERQELRLDGFTQIIPQAGDLVVPGSPEIPPVEGDIGKTLGRWNPYTEHKHIKVLENNKKDIKVNKETEKKKPYKIPKIDRSNPKALGLKPYERKPKSGSNKWKETFKMEVKDAIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.61
3 0.62
4 0.67
5 0.66
6 0.68
7 0.66
8 0.67
9 0.64
10 0.69
11 0.74
12 0.69
13 0.66
14 0.62
15 0.56
16 0.5
17 0.48
18 0.42
19 0.38
20 0.37
21 0.35
22 0.33
23 0.34
24 0.35
25 0.34
26 0.32
27 0.28
28 0.24
29 0.21
30 0.17
31 0.16
32 0.14
33 0.13
34 0.12
35 0.12
36 0.14
37 0.13
38 0.16
39 0.16
40 0.18
41 0.2
42 0.23
43 0.23
44 0.23
45 0.23
46 0.23
47 0.23
48 0.25
49 0.25
50 0.24
51 0.25
52 0.29
53 0.31
54 0.29
55 0.33
56 0.37
57 0.37
58 0.39
59 0.39
60 0.36
61 0.36
62 0.36
63 0.31
64 0.23
65 0.2
66 0.15
67 0.14
68 0.12
69 0.09
70 0.07
71 0.06
72 0.06
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.05
84 0.05
85 0.05
86 0.06
87 0.07
88 0.07
89 0.07
90 0.08
91 0.09
92 0.08
93 0.08
94 0.09
95 0.1
96 0.13
97 0.14
98 0.15
99 0.17
100 0.25
101 0.31
102 0.35
103 0.41
104 0.4
105 0.45
106 0.45
107 0.48
108 0.48
109 0.53
110 0.57
111 0.54
112 0.57
113 0.54
114 0.54
115 0.51
116 0.51
117 0.48
118 0.48
119 0.5
120 0.55
121 0.62
122 0.66
123 0.72
124 0.75
125 0.73
126 0.72
127 0.75
128 0.76
129 0.77
130 0.82
131 0.83
132 0.83
133 0.87
134 0.89
135 0.9
136 0.86
137 0.83
138 0.75
139 0.7
140 0.65
141 0.56
142 0.56
143 0.51
144 0.53
145 0.53
146 0.59
147 0.65
148 0.61
149 0.64
150 0.61
151 0.65
152 0.67
153 0.7
154 0.72
155 0.71
156 0.8
157 0.79
158 0.82
159 0.75
160 0.7
161 0.68
162 0.65
163 0.63
164 0.55
165 0.56