Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4MCW9

Protein Details
Accession A0A1G4MCW9    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
286-312FIDSLKQSKKSSKKRSTGRNSKIEHDEHydrophilic
NLS Segment(s)
PositionSequence
294-300KKSSKKR
Subcellular Location(s) nucl 13, mito 10, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR044569  PDIA6-like  
IPR036249  Thioredoxin-like_sf  
IPR017937  Thioredoxin_CS  
IPR013766  Thioredoxin_domain  
Gene Ontology GO:0003756  F:protein disulfide isomerase activity  
Pfam View protein in Pfam  
PF00085  Thioredoxin  
PROSITE View protein in PROSITE  
PS00194  THIOREDOXIN_1  
PS51352  THIOREDOXIN_2  
CDD cd03002  PDI_a_MPD1_like  
Amino Acid Sequences MNIKGFFWLLFWVSLVNGQSFYEKSPHIIELTPKTFRKVIHETNYTTLVEFYAPWCGHCQQLKGIMERVARNLDGIVQVASVNCDLAKNKQLCAQHRIQGFPTLMVFRPPKVDLNKAPEDAIRLGNHASEIYKGERKLRAIADFSVSRVKNYVRRISKVNTLIDILQKEQSRYSAVLFAKKDKISPLFKSLALDWLGTIDFYTIPISKLDAKAQVSSTNASNITSFVQKFSELEHKEDKSVLVLFDNKEDRYYIFEDKLLNKLDIAMFLSQFAEPTEGPLTKRQEFIDSLKQSKKSSKKRSTGRNSKIEHDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.13
4 0.12
5 0.13
6 0.15
7 0.15
8 0.17
9 0.18
10 0.17
11 0.19
12 0.21
13 0.23
14 0.22
15 0.24
16 0.28
17 0.33
18 0.38
19 0.42
20 0.41
21 0.43
22 0.44
23 0.43
24 0.45
25 0.45
26 0.49
27 0.51
28 0.56
29 0.55
30 0.55
31 0.57
32 0.49
33 0.4
34 0.31
35 0.22
36 0.17
37 0.14
38 0.11
39 0.16
40 0.15
41 0.16
42 0.19
43 0.2
44 0.25
45 0.28
46 0.3
47 0.26
48 0.34
49 0.36
50 0.35
51 0.38
52 0.37
53 0.38
54 0.37
55 0.36
56 0.31
57 0.27
58 0.25
59 0.21
60 0.18
61 0.14
62 0.13
63 0.1
64 0.08
65 0.08
66 0.08
67 0.09
68 0.07
69 0.06
70 0.06
71 0.07
72 0.08
73 0.12
74 0.19
75 0.19
76 0.2
77 0.26
78 0.31
79 0.35
80 0.4
81 0.42
82 0.4
83 0.41
84 0.42
85 0.38
86 0.37
87 0.33
88 0.27
89 0.23
90 0.2
91 0.18
92 0.21
93 0.21
94 0.16
95 0.19
96 0.2
97 0.24
98 0.26
99 0.32
100 0.32
101 0.38
102 0.41
103 0.39
104 0.38
105 0.32
106 0.31
107 0.27
108 0.25
109 0.17
110 0.14
111 0.14
112 0.13
113 0.13
114 0.11
115 0.09
116 0.07
117 0.09
118 0.11
119 0.15
120 0.16
121 0.2
122 0.23
123 0.23
124 0.27
125 0.27
126 0.27
127 0.25
128 0.25
129 0.24
130 0.21
131 0.21
132 0.24
133 0.21
134 0.19
135 0.19
136 0.2
137 0.22
138 0.27
139 0.35
140 0.32
141 0.34
142 0.38
143 0.39
144 0.44
145 0.43
146 0.39
147 0.31
148 0.28
149 0.27
150 0.25
151 0.23
152 0.17
153 0.16
154 0.16
155 0.16
156 0.15
157 0.15
158 0.14
159 0.14
160 0.14
161 0.16
162 0.16
163 0.21
164 0.22
165 0.25
166 0.28
167 0.28
168 0.28
169 0.25
170 0.3
171 0.29
172 0.31
173 0.33
174 0.3
175 0.3
176 0.31
177 0.28
178 0.26
179 0.22
180 0.19
181 0.13
182 0.12
183 0.11
184 0.09
185 0.09
186 0.05
187 0.04
188 0.05
189 0.07
190 0.06
191 0.07
192 0.08
193 0.09
194 0.12
195 0.14
196 0.15
197 0.19
198 0.19
199 0.21
200 0.22
201 0.22
202 0.2
203 0.2
204 0.19
205 0.17
206 0.16
207 0.15
208 0.14
209 0.13
210 0.13
211 0.15
212 0.15
213 0.13
214 0.14
215 0.14
216 0.14
217 0.17
218 0.25
219 0.22
220 0.27
221 0.32
222 0.33
223 0.33
224 0.34
225 0.31
226 0.23
227 0.23
228 0.18
229 0.14
230 0.17
231 0.17
232 0.22
233 0.25
234 0.23
235 0.22
236 0.23
237 0.21
238 0.22
239 0.25
240 0.24
241 0.22
242 0.24
243 0.27
244 0.28
245 0.33
246 0.31
247 0.27
248 0.22
249 0.23
250 0.21
251 0.19
252 0.19
253 0.15
254 0.12
255 0.13
256 0.14
257 0.12
258 0.11
259 0.11
260 0.11
261 0.1
262 0.13
263 0.16
264 0.17
265 0.19
266 0.26
267 0.32
268 0.32
269 0.36
270 0.34
271 0.35
272 0.37
273 0.41
274 0.45
275 0.44
276 0.49
277 0.52
278 0.55
279 0.55
280 0.61
281 0.65
282 0.66
283 0.71
284 0.75
285 0.78
286 0.83
287 0.9
288 0.92
289 0.92
290 0.91
291 0.9
292 0.83
293 0.81