Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4MCG3

Protein Details
Accession A0A1G4MCG3    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-36NAVQIAEKARKRRKRVSKDVKLSADQHydrophilic
NLS Segment(s)
PositionSequence
18-28KARKRRKRVSK
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF00010  HLH  
PROSITE View protein in PROSITE  
PS50888  BHLH  
Amino Acid Sequences MQSMPSSGEHNAVQIAEKARKRRKRVSKDVKLSADQKRENHVSSEQRRRQAMRDSYDKLVEVVPGIEKAENRSELLIYTKTYHYLMWLYARNSTLRKELGEKAVAKGMHGFSEDKLPGHLHWSTPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.25
4 0.3
5 0.39
6 0.49
7 0.57
8 0.65
9 0.72
10 0.78
11 0.81
12 0.87
13 0.89
14 0.89
15 0.9
16 0.9
17 0.84
18 0.79
19 0.75
20 0.71
21 0.68
22 0.62
23 0.55
24 0.53
25 0.51
26 0.47
27 0.43
28 0.42
29 0.43
30 0.47
31 0.56
32 0.54
33 0.56
34 0.58
35 0.57
36 0.55
37 0.55
38 0.53
39 0.47
40 0.48
41 0.47
42 0.45
43 0.44
44 0.39
45 0.3
46 0.24
47 0.18
48 0.11
49 0.08
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.08
56 0.11
57 0.11
58 0.12
59 0.12
60 0.11
61 0.11
62 0.14
63 0.12
64 0.11
65 0.12
66 0.12
67 0.13
68 0.14
69 0.13
70 0.12
71 0.12
72 0.13
73 0.15
74 0.18
75 0.18
76 0.2
77 0.21
78 0.23
79 0.23
80 0.24
81 0.24
82 0.22
83 0.23
84 0.25
85 0.29
86 0.31
87 0.35
88 0.34
89 0.31
90 0.35
91 0.33
92 0.28
93 0.28
94 0.24
95 0.2
96 0.2
97 0.19
98 0.15
99 0.23
100 0.24
101 0.2
102 0.21
103 0.21
104 0.2
105 0.24
106 0.24
107 0.21