Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4MF90

Protein Details
Accession A0A1G4MF90   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
77-106LSEDPLKLRKKQMRKANRKHIKQNNFLSEIHydrophilic
NLS Segment(s)
PositionSequence
82-96LKLRKKQMRKANRKH
Subcellular Location(s) mito 18, nucl 8.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MILASLRISFKRGISTGSKLLQQEKAIISGIKSSCPAGTPLNLQIKKSGKEITALEDSEYPEWLWTVLDQKAQEKKLSEDPLKLRKKQMRKANRKHIKQNNFLSEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.35
4 0.35
5 0.37
6 0.33
7 0.37
8 0.36
9 0.32
10 0.31
11 0.26
12 0.25
13 0.22
14 0.21
15 0.17
16 0.19
17 0.18
18 0.16
19 0.15
20 0.15
21 0.14
22 0.14
23 0.16
24 0.12
25 0.13
26 0.14
27 0.19
28 0.28
29 0.29
30 0.28
31 0.32
32 0.34
33 0.35
34 0.35
35 0.31
36 0.22
37 0.24
38 0.24
39 0.22
40 0.21
41 0.19
42 0.18
43 0.16
44 0.17
45 0.14
46 0.14
47 0.1
48 0.07
49 0.07
50 0.07
51 0.06
52 0.05
53 0.08
54 0.09
55 0.12
56 0.13
57 0.18
58 0.24
59 0.26
60 0.28
61 0.27
62 0.29
63 0.35
64 0.42
65 0.39
66 0.4
67 0.46
68 0.53
69 0.59
70 0.6
71 0.62
72 0.63
73 0.7
74 0.73
75 0.76
76 0.77
77 0.81
78 0.88
79 0.89
80 0.91
81 0.91
82 0.92
83 0.92
84 0.91
85 0.89
86 0.88