Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4M8G9

Protein Details
Accession A0A1G4M8G9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASLPHPKIVKKHTKKFKRHHSDRYIRVAENHydrophilic
NLS Segment(s)
PositionSequence
9-23KIVKKHTKKFKRHHS
Subcellular Location(s) mito 13.5, mito_nucl 12, nucl 9.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKHTKKFKRHHSDRYIRVAENWRKQKGIDSVVRRRFRGNISEPTIGYGSNKKTKFLSPSGHKTFLVSNIKDLELLMMHTRTYAAEIAHNVSSKNRVTILARAKALGVKVTNPNGRLGLAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.88
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.92
11 0.89
12 0.88
13 0.81
14 0.7
15 0.66
16 0.65
17 0.63
18 0.63
19 0.63
20 0.56
21 0.52
22 0.52
23 0.53
24 0.49
25 0.47
26 0.45
27 0.46
28 0.53
29 0.62
30 0.66
31 0.6
32 0.55
33 0.51
34 0.47
35 0.46
36 0.42
37 0.41
38 0.42
39 0.43
40 0.41
41 0.39
42 0.36
43 0.28
44 0.23
45 0.19
46 0.18
47 0.23
48 0.24
49 0.23
50 0.25
51 0.27
52 0.31
53 0.31
54 0.34
55 0.34
56 0.43
57 0.47
58 0.48
59 0.45
60 0.41
61 0.37
62 0.38
63 0.38
64 0.29
65 0.26
66 0.25
67 0.25
68 0.24
69 0.22
70 0.15
71 0.08
72 0.09
73 0.09
74 0.08
75 0.08
76 0.08
77 0.08
78 0.08
79 0.09
80 0.09
81 0.08
82 0.09
83 0.11
84 0.14
85 0.15
86 0.16
87 0.15
88 0.15
89 0.19
90 0.18
91 0.19
92 0.17
93 0.18
94 0.2
95 0.28
96 0.35
97 0.36
98 0.36
99 0.34
100 0.34
101 0.34
102 0.32
103 0.29
104 0.22
105 0.2
106 0.27
107 0.34
108 0.38
109 0.37
110 0.39
111 0.35