Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4EQL7

Protein Details
Accession A0A0C4EQL7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MVKIPKLKTKSKRMIPAGNCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MVKIPKLKTKSKRMIPAGNCALELSGLLQCWATTSDVHSMGQCAESAKNLSTCMKTAKAGNAKKTDSINFHLARLGKNFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.76
3 0.76
4 0.7
5 0.61
6 0.52
7 0.42
8 0.34
9 0.24
10 0.21
11 0.12
12 0.07
13 0.06
14 0.06
15 0.06
16 0.06
17 0.07
18 0.08
19 0.07
20 0.06
21 0.08
22 0.11
23 0.12
24 0.12
25 0.11
26 0.11
27 0.1
28 0.1
29 0.09
30 0.07
31 0.06
32 0.07
33 0.08
34 0.09
35 0.09
36 0.11
37 0.13
38 0.13
39 0.14
40 0.17
41 0.17
42 0.18
43 0.2
44 0.26
45 0.34
46 0.38
47 0.44
48 0.47
49 0.48
50 0.5
51 0.51
52 0.48
53 0.43
54 0.43
55 0.44
56 0.39
57 0.38
58 0.38
59 0.36
60 0.35