Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4M9W2

Protein Details
Accession A0A1G4M9W2   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
253-272KGIPQEKFKQLSKKERRHKMBasic
NLS Segment(s)
PositionSequence
265-271KKERRHK
Subcellular Location(s) nucl 13, cyto_nucl 10.5, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029045  ClpP/crotonase-like_dom_sf  
IPR001753  Enoyl-CoA_hydra/iso  
Gene Ontology GO:0043231  C:intracellular membrane-bounded organelle  
GO:0016020  C:membrane  
GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF00378  ECH_1  
CDD cd06558  crotonase-like  
Amino Acid Sequences MTRSSSKISHQISGEYFIISLNDPNTLNSMTGEDYVYLATLLQEADRNDAIYFTVLQSSGRFFSSGANVSNIGKAQKSESASGETGKWLSEFVSRNLFVTQIFSNHRKLLICCLNGPAVGLSATIVMLCDIVYSMNDSVYLLFPFTTLGLVSEGALSVTLPLKLGYNVANEILTFGKPVTFENMIGKVIIKNYNMKDTNEFNKKVVEDLRERTQHLYKDSIIGIKKLLKRPFESELKRANVDEVSDALDFWVKGIPQEKFKQLSKKERRHKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.28
3 0.24
4 0.19
5 0.19
6 0.15
7 0.15
8 0.11
9 0.13
10 0.13
11 0.14
12 0.16
13 0.16
14 0.16
15 0.14
16 0.15
17 0.13
18 0.14
19 0.14
20 0.11
21 0.11
22 0.1
23 0.1
24 0.08
25 0.06
26 0.06
27 0.06
28 0.05
29 0.06
30 0.09
31 0.09
32 0.13
33 0.14
34 0.14
35 0.14
36 0.14
37 0.14
38 0.12
39 0.12
40 0.09
41 0.1
42 0.09
43 0.1
44 0.1
45 0.12
46 0.12
47 0.12
48 0.12
49 0.11
50 0.13
51 0.17
52 0.19
53 0.17
54 0.18
55 0.18
56 0.18
57 0.2
58 0.18
59 0.15
60 0.13
61 0.13
62 0.13
63 0.17
64 0.19
65 0.19
66 0.2
67 0.23
68 0.23
69 0.23
70 0.21
71 0.18
72 0.16
73 0.14
74 0.12
75 0.08
76 0.08
77 0.13
78 0.14
79 0.15
80 0.21
81 0.21
82 0.22
83 0.22
84 0.21
85 0.15
86 0.16
87 0.15
88 0.13
89 0.17
90 0.19
91 0.21
92 0.22
93 0.24
94 0.22
95 0.22
96 0.27
97 0.29
98 0.27
99 0.25
100 0.26
101 0.24
102 0.23
103 0.22
104 0.14
105 0.08
106 0.07
107 0.06
108 0.04
109 0.04
110 0.04
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.02
117 0.02
118 0.03
119 0.03
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.05
126 0.06
127 0.06
128 0.05
129 0.04
130 0.05
131 0.05
132 0.05
133 0.04
134 0.04
135 0.04
136 0.05
137 0.05
138 0.05
139 0.05
140 0.04
141 0.04
142 0.04
143 0.03
144 0.04
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.06
151 0.07
152 0.08
153 0.08
154 0.09
155 0.09
156 0.09
157 0.08
158 0.09
159 0.09
160 0.08
161 0.07
162 0.06
163 0.07
164 0.07
165 0.08
166 0.11
167 0.11
168 0.12
169 0.15
170 0.16
171 0.16
172 0.15
173 0.15
174 0.12
175 0.14
176 0.17
177 0.16
178 0.21
179 0.22
180 0.31
181 0.33
182 0.33
183 0.35
184 0.36
185 0.44
186 0.46
187 0.46
188 0.38
189 0.39
190 0.38
191 0.37
192 0.36
193 0.33
194 0.3
195 0.34
196 0.41
197 0.41
198 0.42
199 0.43
200 0.45
201 0.43
202 0.4
203 0.39
204 0.31
205 0.32
206 0.32
207 0.32
208 0.28
209 0.25
210 0.25
211 0.28
212 0.35
213 0.39
214 0.44
215 0.44
216 0.47
217 0.52
218 0.56
219 0.6
220 0.59
221 0.58
222 0.61
223 0.6
224 0.57
225 0.52
226 0.47
227 0.38
228 0.34
229 0.27
230 0.2
231 0.18
232 0.16
233 0.15
234 0.13
235 0.14
236 0.12
237 0.11
238 0.13
239 0.1
240 0.14
241 0.21
242 0.24
243 0.29
244 0.36
245 0.42
246 0.46
247 0.52
248 0.59
249 0.62
250 0.7
251 0.74
252 0.79