Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1G4M7P9

Protein Details
Accession A0A1G4M7P9    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
97-116ASRVTEKQRKKQIAFPQRKYHydrophilic
NLS Segment(s)
PositionSequence
78-108KDLRAKKTRALRRALTKFEASRVTEKQRKKQ
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAGIKTYELRTKSKEQLESQLLGLKKELAELKVQKLSRPSLPKIHTVRKDIARVLTVINENQRQAVRELYKGSKYQPKDLRAKKTRALRRALTKFEASRVTEKQRKKQIAFPQRKYAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.53
3 0.58
4 0.58
5 0.54
6 0.47
7 0.44
8 0.37
9 0.31
10 0.28
11 0.2
12 0.16
13 0.18
14 0.19
15 0.15
16 0.21
17 0.24
18 0.28
19 0.32
20 0.33
21 0.31
22 0.33
23 0.36
24 0.36
25 0.39
26 0.39
27 0.41
28 0.43
29 0.49
30 0.52
31 0.58
32 0.56
33 0.53
34 0.56
35 0.52
36 0.52
37 0.45
38 0.4
39 0.32
40 0.27
41 0.23
42 0.19
43 0.15
44 0.14
45 0.15
46 0.15
47 0.14
48 0.15
49 0.15
50 0.14
51 0.14
52 0.18
53 0.16
54 0.17
55 0.2
56 0.21
57 0.24
58 0.24
59 0.27
60 0.3
61 0.31
62 0.38
63 0.42
64 0.46
65 0.54
66 0.6
67 0.67
68 0.68
69 0.71
70 0.68
71 0.71
72 0.73
73 0.7
74 0.69
75 0.65
76 0.68
77 0.7
78 0.69
79 0.63
80 0.6
81 0.54
82 0.51
83 0.5
84 0.42
85 0.41
86 0.41
87 0.47
88 0.49
89 0.56
90 0.61
91 0.66
92 0.72
93 0.7
94 0.73
95 0.74
96 0.78
97 0.81
98 0.79
99 0.79
100 0.77