Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4MJF2

Protein Details
Accession A0A1G4MJF2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
49-91TFGSTKNKKVQPKKSGGKRVEKKPNNLKYRQYVNKNKKKVTQDHydrophilic
NLS Segment(s)
PositionSequence
54-78KNKKVQPKKSGGKRVEKKPNNLKYR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MKSEATQQTQPSDGSDPINKQKGHNIKDTKQSLTGQDQSGIASVMGFATFGSTKNKKVQPKKSGGKRVEKKPNNLKYRQYVNKNKKKVTQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.29
4 0.34
5 0.41
6 0.39
7 0.37
8 0.45
9 0.5
10 0.5
11 0.54
12 0.54
13 0.51
14 0.6
15 0.62
16 0.55
17 0.5
18 0.47
19 0.41
20 0.39
21 0.38
22 0.29
23 0.26
24 0.24
25 0.21
26 0.19
27 0.16
28 0.1
29 0.06
30 0.05
31 0.04
32 0.03
33 0.03
34 0.03
35 0.03
36 0.04
37 0.05
38 0.12
39 0.13
40 0.16
41 0.24
42 0.31
43 0.39
44 0.49
45 0.58
46 0.62
47 0.7
48 0.77
49 0.8
50 0.84
51 0.82
52 0.84
53 0.83
54 0.83
55 0.84
56 0.82
57 0.82
58 0.83
59 0.85
60 0.83
61 0.81
62 0.78
63 0.75
64 0.79
65 0.78
66 0.78
67 0.79
68 0.82
69 0.85
70 0.87
71 0.86