Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4MF86

Protein Details
Accession A0A1G4MF86   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
71-90ELAQLKKEYEQHKKDRKNQNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, nucl 6, golg 5, E.R. 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR041752  Coa3  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Amino Acid Sequences MVFEPSRYQDQRTWKMTPAMIRARAPFFKKNLAGLALLVGVTGGIYVYTYRFLNKDNDFADVPIPPIDEKELAQLKKEYEQHKKDRKNQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.51
4 0.5
5 0.48
6 0.47
7 0.46
8 0.45
9 0.44
10 0.44
11 0.46
12 0.46
13 0.44
14 0.39
15 0.41
16 0.4
17 0.38
18 0.35
19 0.31
20 0.26
21 0.2
22 0.18
23 0.11
24 0.09
25 0.07
26 0.05
27 0.03
28 0.03
29 0.02
30 0.02
31 0.01
32 0.02
33 0.02
34 0.03
35 0.04
36 0.05
37 0.06
38 0.07
39 0.09
40 0.15
41 0.17
42 0.21
43 0.2
44 0.23
45 0.23
46 0.23
47 0.22
48 0.16
49 0.16
50 0.12
51 0.12
52 0.09
53 0.09
54 0.11
55 0.11
56 0.11
57 0.17
58 0.24
59 0.24
60 0.27
61 0.29
62 0.29
63 0.35
64 0.42
65 0.42
66 0.46
67 0.55
68 0.63
69 0.71
70 0.79