Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4MJU1

Protein Details
Accession A0A1G4MJU1    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VNVPKTRKTYCKGKQCRKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKGKQCRKHTQHKVTQYKAGKASLYAQGKRRYDRKQSGFGGQTKQIFHKKAKTTKKVVLRLECVVCKTKAQLALKRCKHFELGGEKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.86
4 0.91
5 0.89
6 0.91
7 0.91
8 0.9
9 0.89
10 0.89
11 0.89
12 0.82
13 0.82
14 0.75
15 0.7
16 0.62
17 0.55
18 0.44
19 0.35
20 0.34
21 0.33
22 0.34
23 0.32
24 0.35
25 0.41
26 0.44
27 0.48
28 0.53
29 0.52
30 0.56
31 0.62
32 0.61
33 0.61
34 0.6
35 0.61
36 0.58
37 0.54
38 0.47
39 0.4
40 0.37
41 0.3
42 0.32
43 0.31
44 0.3
45 0.3
46 0.35
47 0.4
48 0.47
49 0.57
50 0.6
51 0.61
52 0.65
53 0.71
54 0.71
55 0.7
56 0.66
57 0.6
58 0.57
59 0.54
60 0.48
61 0.42
62 0.38
63 0.31
64 0.27
65 0.25
66 0.24
67 0.28
68 0.33
69 0.37
70 0.42
71 0.52
72 0.6
73 0.64
74 0.63
75 0.58
76 0.55
77 0.5
78 0.49
79 0.49
80 0.5
81 0.53
82 0.59
83 0.57
84 0.58
85 0.61
86 0.57