Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4MAD4

Protein Details
Accession A0A1G4MAD4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-44DTSGLKLKRSSWKRPNRRHKATRQLMTDEHydrophilic
NLS Segment(s)
PositionSequence
22-35LKRSSWKRPNRRHK
Subcellular Location(s) nucl 17, mito_nucl 12.666, cyto_nucl 11.666, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MDNKLEYLRSVAAQNDTSGLKLKRSSWKRPNRRHKATRQLMTDEWKRVTNANSDKNMLTYFNVEAPPSIYPAKKYCDITGLKASYKAPGNGLRFHNSEVYSLVIKPMAPGVDQEYLKLRGDNVVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.18
4 0.18
5 0.22
6 0.21
7 0.2
8 0.22
9 0.28
10 0.36
11 0.43
12 0.53
13 0.57
14 0.68
15 0.75
16 0.84
17 0.9
18 0.9
19 0.93
20 0.93
21 0.92
22 0.92
23 0.91
24 0.88
25 0.81
26 0.74
27 0.66
28 0.63
29 0.58
30 0.51
31 0.43
32 0.36
33 0.32
34 0.3
35 0.29
36 0.3
37 0.32
38 0.34
39 0.34
40 0.35
41 0.34
42 0.33
43 0.31
44 0.23
45 0.17
46 0.12
47 0.11
48 0.11
49 0.11
50 0.1
51 0.09
52 0.1
53 0.09
54 0.1
55 0.11
56 0.1
57 0.12
58 0.15
59 0.18
60 0.21
61 0.23
62 0.21
63 0.27
64 0.28
65 0.29
66 0.33
67 0.32
68 0.28
69 0.29
70 0.29
71 0.26
72 0.27
73 0.24
74 0.21
75 0.26
76 0.28
77 0.32
78 0.35
79 0.35
80 0.34
81 0.35
82 0.35
83 0.29
84 0.27
85 0.22
86 0.21
87 0.18
88 0.16
89 0.15
90 0.12
91 0.11
92 0.11
93 0.12
94 0.11
95 0.1
96 0.11
97 0.14
98 0.2
99 0.2
100 0.21
101 0.24
102 0.26
103 0.27
104 0.27
105 0.23
106 0.2