Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4F1T0

Protein Details
Accession A0A0C4F1T0    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-84CAESKCSKYKRHFDHCQERVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10cyto_nucl 10, nucl 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR003422  Cyt_b-c1_6  
IPR023184  Ubol_cytC_Rdtase_hinge_dom  
IPR036811  Ubol_cytC_Rdtase_hinge_dom_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF02320  UCR_hinge  
Amino Acid Sequences MTNSNSSTSSSPPATSFTEVCSNVASAITQYFTPTVVAEAKEATEEEEEEEDEPEDPAPAIREECAESKCSKYKRHFDHCQERVLGGKGDKGEDCVEELFHLMHCVDECCLKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.24
4 0.23
5 0.28
6 0.27
7 0.27
8 0.24
9 0.21
10 0.18
11 0.18
12 0.14
13 0.08
14 0.08
15 0.08
16 0.07
17 0.08
18 0.08
19 0.08
20 0.08
21 0.07
22 0.08
23 0.1
24 0.1
25 0.09
26 0.1
27 0.09
28 0.09
29 0.09
30 0.08
31 0.07
32 0.07
33 0.07
34 0.08
35 0.08
36 0.08
37 0.08
38 0.07
39 0.07
40 0.07
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.08
51 0.11
52 0.12
53 0.13
54 0.14
55 0.18
56 0.24
57 0.28
58 0.34
59 0.4
60 0.49
61 0.57
62 0.65
63 0.71
64 0.75
65 0.81
66 0.77
67 0.74
68 0.65
69 0.56
70 0.49
71 0.42
72 0.34
73 0.24
74 0.24
75 0.19
76 0.21
77 0.2
78 0.2
79 0.19
80 0.16
81 0.17
82 0.15
83 0.14
84 0.12
85 0.13
86 0.11
87 0.1
88 0.1
89 0.08
90 0.09
91 0.1
92 0.1
93 0.11