Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4MCC8

Protein Details
Accession A0A1G4MCC8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
28-52VIARLKDKPSKEKKSEKKDPKTIIVHydrophilic
NLS Segment(s)
PositionSequence
33-45KDKPSKEKKSEKK
Subcellular Location(s) extr 7, mito 5, E.R. 5, golg 3, mito_nucl 3, cyto 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024359  Peroxin-22  
IPR038613  Peroxin-22_C_sf  
Gene Ontology GO:0005778  C:peroxisomal membrane  
GO:0007031  P:peroxisome organization  
Pfam View protein in Pfam  
PF12827  Peroxin-22  
Amino Acid Sequences MTRKTKNRVVGRVLVTGILVAAAVGLFVIARLKDKPSKEKKSEKKDPKTIIVTNTVYRAVDNWESILQDDVVLLIPPNCGFKDDLQSLDRDNSHKIIGCDTMEGLWSVTRHLRKKELVLLPGELDGIPDDLARYCERIVRLGADNIAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.35
3 0.27
4 0.2
5 0.11
6 0.07
7 0.04
8 0.03
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.04
16 0.04
17 0.06
18 0.08
19 0.13
20 0.19
21 0.25
22 0.35
23 0.44
24 0.54
25 0.62
26 0.71
27 0.77
28 0.82
29 0.88
30 0.88
31 0.88
32 0.87
33 0.83
34 0.79
35 0.76
36 0.68
37 0.6
38 0.55
39 0.47
40 0.39
41 0.35
42 0.29
43 0.22
44 0.19
45 0.16
46 0.14
47 0.13
48 0.12
49 0.11
50 0.11
51 0.11
52 0.11
53 0.11
54 0.07
55 0.06
56 0.06
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.06
65 0.05
66 0.06
67 0.08
68 0.09
69 0.14
70 0.15
71 0.18
72 0.17
73 0.18
74 0.18
75 0.19
76 0.2
77 0.16
78 0.16
79 0.15
80 0.16
81 0.17
82 0.17
83 0.16
84 0.17
85 0.15
86 0.14
87 0.13
88 0.12
89 0.1
90 0.09
91 0.08
92 0.07
93 0.07
94 0.08
95 0.14
96 0.21
97 0.26
98 0.3
99 0.36
100 0.38
101 0.43
102 0.5
103 0.5
104 0.47
105 0.44
106 0.41
107 0.36
108 0.33
109 0.28
110 0.19
111 0.14
112 0.1
113 0.09
114 0.07
115 0.07
116 0.07
117 0.07
118 0.1
119 0.11
120 0.12
121 0.13
122 0.17
123 0.18
124 0.2
125 0.22
126 0.23
127 0.26
128 0.27