Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4MKY7

Protein Details
Accession A0A1G4MKY7   
Localization Confidence High
Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
75-97SITNGRIEKKKRHQKSKDVIGMSHydrophilic
110-132EEVASQPKSNSKKNKKKNKNKKRBasic
NLS Segment(s)
PositionSequence
83-87KKKRH
118-132SNSKKNKKKNKNKKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009018  Signal_recog_particle_SRP9/14  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MSIKPLDSFITNSISLLEANPSQTLVSISYRNKDGQSLASFKAHNSHLGTTYKFRTSKSKDVSRLLSALGPRGVSITNGRIEKKKRHQKSKDVIGMSSLLVNTDVKEAVEEVASQPKSNSKKNKKKNKNKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.13
4 0.14
5 0.1
6 0.12
7 0.12
8 0.12
9 0.11
10 0.11
11 0.11
12 0.1
13 0.12
14 0.17
15 0.19
16 0.22
17 0.24
18 0.26
19 0.26
20 0.25
21 0.24
22 0.23
23 0.25
24 0.26
25 0.25
26 0.27
27 0.26
28 0.25
29 0.28
30 0.23
31 0.23
32 0.21
33 0.2
34 0.21
35 0.23
36 0.25
37 0.24
38 0.26
39 0.28
40 0.27
41 0.27
42 0.32
43 0.37
44 0.44
45 0.49
46 0.54
47 0.53
48 0.56
49 0.57
50 0.49
51 0.43
52 0.34
53 0.28
54 0.21
55 0.17
56 0.13
57 0.1
58 0.09
59 0.09
60 0.08
61 0.08
62 0.09
63 0.1
64 0.14
65 0.16
66 0.18
67 0.23
68 0.28
69 0.37
70 0.46
71 0.55
72 0.61
73 0.7
74 0.77
75 0.82
76 0.86
77 0.87
78 0.84
79 0.75
80 0.65
81 0.55
82 0.48
83 0.37
84 0.28
85 0.17
86 0.1
87 0.09
88 0.09
89 0.08
90 0.08
91 0.09
92 0.07
93 0.08
94 0.08
95 0.08
96 0.08
97 0.08
98 0.09
99 0.17
100 0.17
101 0.17
102 0.18
103 0.25
104 0.31
105 0.4
106 0.49
107 0.53
108 0.63
109 0.74
110 0.85
111 0.88
112 0.93