Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1G4MA75

Protein Details
Accession A0A1G4MA75   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-44LLWKIPWRMSRPQKQRQRHRLQQVDKVLKNHydrophilic
109-131YRKGLHKLPKWTKVSQRRNPKFFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 3.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFKPSSTVLGGLLWKIPWRMSRPQKQRQRHRLQQVDKVLKNLNLGLHIQRCEKKGIEFESALQTRKLLKPQVKHLRLLSKASVFPKEREMSYKDKYTFFNKQASGYRKGLHKLPKWTKVSQRRNPKFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.16
4 0.15
5 0.14
6 0.16
7 0.2
8 0.24
9 0.34
10 0.43
11 0.53
12 0.61
13 0.71
14 0.78
15 0.84
16 0.9
17 0.9
18 0.91
19 0.9
20 0.9
21 0.9
22 0.86
23 0.84
24 0.83
25 0.81
26 0.71
27 0.65
28 0.57
29 0.48
30 0.43
31 0.35
32 0.26
33 0.18
34 0.19
35 0.18
36 0.18
37 0.19
38 0.22
39 0.24
40 0.24
41 0.25
42 0.25
43 0.23
44 0.25
45 0.26
46 0.25
47 0.22
48 0.22
49 0.26
50 0.27
51 0.26
52 0.21
53 0.19
54 0.19
55 0.2
56 0.23
57 0.22
58 0.26
59 0.29
60 0.4
61 0.5
62 0.5
63 0.51
64 0.51
65 0.52
66 0.5
67 0.49
68 0.41
69 0.33
70 0.34
71 0.33
72 0.36
73 0.31
74 0.3
75 0.34
76 0.33
77 0.31
78 0.32
79 0.34
80 0.34
81 0.37
82 0.43
83 0.39
84 0.39
85 0.42
86 0.45
87 0.49
88 0.46
89 0.48
90 0.41
91 0.44
92 0.49
93 0.52
94 0.51
95 0.46
96 0.46
97 0.44
98 0.46
99 0.48
100 0.5
101 0.51
102 0.56
103 0.63
104 0.68
105 0.69
106 0.73
107 0.77
108 0.78
109 0.82
110 0.81
111 0.83