Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4F9X9

Protein Details
Accession A0A0C4F9X9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
90-116AASGSKPKPYKQKPKKGENKWKETFCMHydrophilic
NLS Segment(s)
PositionSequence
58-109KVLEKNKQPTKESKERNLKKPYKIPKINQSKPAASGSKPKPYKQKPKKGENK
Subcellular Location(s) nucl 18, cyto_nucl 11.833, mito_nucl 11.833, mito 4.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MKAVYFNAKNYEEMDLLKSYLKQAILSFQVIQKFLPWKELVNKDSDGWNPYTERKHIKVLEKNKQPTKESKERNLKKPYKIPKINQSKPAASGSKPKPYKQKPKKGENKWKETFCMAQVLMEVKDAIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.19
3 0.18
4 0.19
5 0.18
6 0.16
7 0.18
8 0.18
9 0.16
10 0.15
11 0.19
12 0.2
13 0.21
14 0.21
15 0.2
16 0.22
17 0.21
18 0.21
19 0.2
20 0.22
21 0.21
22 0.24
23 0.22
24 0.22
25 0.3
26 0.36
27 0.34
28 0.33
29 0.34
30 0.3
31 0.32
32 0.31
33 0.26
34 0.2
35 0.21
36 0.18
37 0.21
38 0.23
39 0.24
40 0.28
41 0.28
42 0.33
43 0.37
44 0.43
45 0.47
46 0.54
47 0.59
48 0.62
49 0.67
50 0.66
51 0.65
52 0.6
53 0.59
54 0.59
55 0.59
56 0.56
57 0.59
58 0.65
59 0.68
60 0.74
61 0.77
62 0.75
63 0.73
64 0.76
65 0.76
66 0.76
67 0.77
68 0.74
69 0.73
70 0.77
71 0.76
72 0.76
73 0.71
74 0.62
75 0.56
76 0.56
77 0.48
78 0.39
79 0.42
80 0.39
81 0.44
82 0.46
83 0.49
84 0.54
85 0.62
86 0.72
87 0.73
88 0.79
89 0.79
90 0.86
91 0.92
92 0.92
93 0.93
94 0.92
95 0.91
96 0.89
97 0.83
98 0.75
99 0.69
100 0.61
101 0.51
102 0.47
103 0.37
104 0.29
105 0.27
106 0.26
107 0.22
108 0.19
109 0.18