Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8BKX2

Protein Details
Accession A0A1S8BKX2   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
23-45AEGTQLPKKKFYRQRAHANPFSDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14, cyto_nucl 11.833, cyto_mito 9.833, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
IPR025763  Trm8_euk  
IPR003358  tRNA_(Gua-N-7)_MeTrfase_Trmb  
Gene Ontology GO:0005634  C:nucleus  
GO:0008176  F:tRNA (guanine-N7-)-methyltransferase activity  
GO:0000049  F:tRNA binding  
Pfam View protein in Pfam  
PF02390  Methyltransf_4  
PROSITE View protein in PROSITE  
PS51625  SAM_MT_TRMB  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MTGQPNKRQKREEYRSALSEAAAEGTQLPKKKFYRQRAHANPFSDHALTYPAHPGLMDWTSLYPAYAVGPSEEDSAMQTDQPERAEQEEESLAKRRISREVEVADIGCGFGGLLFALSPKLPDTLLLGMEIRTSVTEFVQEKAKALRAQNVGSDAYQNVACLRANAMKFLPNFFRKGQLSKIFLCFPDPHFKARKHKARIVSTTLNTEYAYVLRPGGIVYTITDVEDLHKWMVGHFENHPSFERISDAELENDVCVEVMKTETEEGKKVTRNGGQKFVACFQRPEDPPWP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.74
3 0.69
4 0.6
5 0.48
6 0.39
7 0.29
8 0.22
9 0.15
10 0.12
11 0.1
12 0.13
13 0.17
14 0.22
15 0.23
16 0.3
17 0.34
18 0.45
19 0.54
20 0.61
21 0.68
22 0.72
23 0.81
24 0.84
25 0.89
26 0.85
27 0.79
28 0.71
29 0.62
30 0.57
31 0.46
32 0.35
33 0.26
34 0.23
35 0.19
36 0.18
37 0.2
38 0.16
39 0.15
40 0.15
41 0.14
42 0.15
43 0.16
44 0.14
45 0.11
46 0.11
47 0.12
48 0.12
49 0.12
50 0.08
51 0.07
52 0.08
53 0.08
54 0.08
55 0.07
56 0.08
57 0.09
58 0.11
59 0.11
60 0.1
61 0.1
62 0.12
63 0.11
64 0.1
65 0.1
66 0.1
67 0.12
68 0.13
69 0.13
70 0.13
71 0.14
72 0.16
73 0.14
74 0.15
75 0.16
76 0.16
77 0.17
78 0.21
79 0.21
80 0.21
81 0.24
82 0.24
83 0.29
84 0.32
85 0.33
86 0.33
87 0.33
88 0.32
89 0.3
90 0.28
91 0.21
92 0.16
93 0.14
94 0.07
95 0.06
96 0.04
97 0.03
98 0.03
99 0.02
100 0.02
101 0.02
102 0.03
103 0.03
104 0.03
105 0.04
106 0.05
107 0.05
108 0.05
109 0.06
110 0.08
111 0.08
112 0.08
113 0.09
114 0.08
115 0.08
116 0.08
117 0.07
118 0.05
119 0.04
120 0.05
121 0.05
122 0.04
123 0.08
124 0.09
125 0.1
126 0.15
127 0.15
128 0.15
129 0.16
130 0.2
131 0.19
132 0.19
133 0.25
134 0.22
135 0.23
136 0.23
137 0.23
138 0.21
139 0.17
140 0.17
141 0.11
142 0.09
143 0.09
144 0.08
145 0.06
146 0.07
147 0.07
148 0.06
149 0.08
150 0.11
151 0.12
152 0.13
153 0.13
154 0.16
155 0.17
156 0.19
157 0.24
158 0.21
159 0.25
160 0.24
161 0.29
162 0.27
163 0.3
164 0.34
165 0.34
166 0.36
167 0.35
168 0.38
169 0.33
170 0.31
171 0.32
172 0.27
173 0.24
174 0.3
175 0.29
176 0.32
177 0.36
178 0.42
179 0.49
180 0.57
181 0.64
182 0.62
183 0.67
184 0.71
185 0.73
186 0.73
187 0.7
188 0.66
189 0.58
190 0.55
191 0.49
192 0.41
193 0.33
194 0.27
195 0.2
196 0.14
197 0.14
198 0.1
199 0.09
200 0.08
201 0.08
202 0.08
203 0.07
204 0.07
205 0.06
206 0.06
207 0.08
208 0.09
209 0.09
210 0.09
211 0.08
212 0.1
213 0.12
214 0.12
215 0.1
216 0.12
217 0.12
218 0.12
219 0.17
220 0.17
221 0.18
222 0.19
223 0.27
224 0.27
225 0.29
226 0.32
227 0.29
228 0.28
229 0.26
230 0.26
231 0.17
232 0.19
233 0.2
234 0.18
235 0.17
236 0.17
237 0.17
238 0.15
239 0.14
240 0.11
241 0.08
242 0.07
243 0.06
244 0.06
245 0.06
246 0.07
247 0.08
248 0.1
249 0.15
250 0.18
251 0.2
252 0.23
253 0.28
254 0.33
255 0.35
256 0.4
257 0.42
258 0.49
259 0.51
260 0.56
261 0.55
262 0.53
263 0.55
264 0.54
265 0.56
266 0.5
267 0.47
268 0.42
269 0.48
270 0.46