Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EQJ9

Protein Details
Accession A0A0C4EQJ9   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-35CLASYRKLYRTYRKTSRHPRPPIPRPINSQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR039196  Fmc1  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0033615  P:mitochondrial proton-transporting ATP synthase complex assembly  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
Amino Acid Sequences MSSLTCLASYRKLYRTYRKTSRHPRPPIPRPINSQLRSLINAGLKDHQLDSVVNYLVSSNLHQELVRRYNPADDLTEPERLKATVNRVGLNMPKTIDLETPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.65
3 0.68
4 0.73
5 0.76
6 0.81
7 0.84
8 0.87
9 0.87
10 0.87
11 0.88
12 0.88
13 0.89
14 0.89
15 0.86
16 0.8
17 0.77
18 0.77
19 0.77
20 0.68
21 0.61
22 0.54
23 0.47
24 0.44
25 0.37
26 0.31
27 0.23
28 0.21
29 0.19
30 0.17
31 0.16
32 0.15
33 0.14
34 0.11
35 0.1
36 0.09
37 0.09
38 0.09
39 0.09
40 0.08
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.06
47 0.07
48 0.08
49 0.08
50 0.1
51 0.16
52 0.21
53 0.22
54 0.22
55 0.22
56 0.24
57 0.25
58 0.25
59 0.22
60 0.18
61 0.22
62 0.23
63 0.29
64 0.27
65 0.26
66 0.25
67 0.23
68 0.25
69 0.24
70 0.28
71 0.27
72 0.3
73 0.31
74 0.3
75 0.34
76 0.36
77 0.34
78 0.29
79 0.23
80 0.23
81 0.23
82 0.24