Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2DTK3

Protein Details
Accession A0A0G2DTK3   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
17-41WKIPWRMSAPQKQRQRDRLRSVDRIHydrophilic
80-105IFARYEKKYRKGLHKLPKWTRVSQRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPSQPLSGGLLWKIPWRMSAPQKQRQRDRLRSVDRIIATVDKALAKQGTSTKKLDRWKDEMPTEAEMLAKDKYTIFARYEKKYRKGLHKLPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.2
4 0.23
5 0.23
6 0.19
7 0.19
8 0.21
9 0.28
10 0.35
11 0.45
12 0.5
13 0.58
14 0.66
15 0.73
16 0.78
17 0.81
18 0.82
19 0.82
20 0.81
21 0.82
22 0.8
23 0.77
24 0.7
25 0.66
26 0.55
27 0.46
28 0.38
29 0.29
30 0.22
31 0.16
32 0.15
33 0.09
34 0.09
35 0.09
36 0.08
37 0.07
38 0.09
39 0.14
40 0.18
41 0.21
42 0.24
43 0.26
44 0.31
45 0.38
46 0.43
47 0.42
48 0.44
49 0.45
50 0.48
51 0.46
52 0.44
53 0.39
54 0.35
55 0.29
56 0.23
57 0.2
58 0.14
59 0.14
60 0.12
61 0.09
62 0.08
63 0.08
64 0.11
65 0.13
66 0.15
67 0.16
68 0.24
69 0.3
70 0.36
71 0.46
72 0.52
73 0.56
74 0.62
75 0.68
76 0.7
77 0.75
78 0.78
79 0.79
80 0.8
81 0.84
82 0.85
83 0.87
84 0.82
85 0.8
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79