Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8BIH6

Protein Details
Accession A0A1S8BIH6   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
160-182DVQGSLPRRLRKRNQHSTGHLTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008688  ATP_synth_Bsub_B/MI25  
IPR013837  ATP_synth_F0_suB  
Gene Ontology GO:0000276  C:mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)  
GO:0015078  F:proton transmembrane transporter activity  
GO:0015986  P:proton motive force-driven ATP synthesis  
Pfam View protein in Pfam  
PF05405  Mt_ATP-synt_B  
Amino Acid Sequences MLSLLTVFFAVGKYGGPMYREWAEAQNNKIKGILNSARQEHTQAVQNRIESVKDLSGVIDTTKALFEVSKETAKLEAQAYELEQKTALAHEAKTVLDSWVRYEGQVKQRQQKELAESIIAKIEKELENPKTLKQILDQSVADVESEFPPNEANPRNRANDVQGSLPRRLRKRNQHSTGHLTILRLLHRSSCNTSHRAPRYPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.12
4 0.13
5 0.17
6 0.19
7 0.2
8 0.21
9 0.25
10 0.31
11 0.34
12 0.4
13 0.42
14 0.41
15 0.4
16 0.4
17 0.36
18 0.29
19 0.34
20 0.34
21 0.34
22 0.38
23 0.41
24 0.42
25 0.4
26 0.41
27 0.34
28 0.31
29 0.32
30 0.31
31 0.33
32 0.33
33 0.33
34 0.33
35 0.32
36 0.3
37 0.23
38 0.21
39 0.16
40 0.14
41 0.14
42 0.12
43 0.11
44 0.11
45 0.1
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.06
52 0.06
53 0.06
54 0.1
55 0.12
56 0.14
57 0.14
58 0.14
59 0.16
60 0.16
61 0.17
62 0.14
63 0.12
64 0.11
65 0.11
66 0.11
67 0.15
68 0.15
69 0.13
70 0.12
71 0.11
72 0.11
73 0.11
74 0.11
75 0.07
76 0.07
77 0.08
78 0.09
79 0.09
80 0.09
81 0.09
82 0.08
83 0.08
84 0.09
85 0.09
86 0.11
87 0.12
88 0.11
89 0.13
90 0.18
91 0.26
92 0.33
93 0.36
94 0.41
95 0.45
96 0.48
97 0.48
98 0.46
99 0.41
100 0.37
101 0.33
102 0.26
103 0.22
104 0.2
105 0.21
106 0.18
107 0.13
108 0.1
109 0.13
110 0.12
111 0.14
112 0.2
113 0.18
114 0.23
115 0.25
116 0.26
117 0.28
118 0.29
119 0.27
120 0.24
121 0.3
122 0.27
123 0.3
124 0.29
125 0.24
126 0.24
127 0.23
128 0.2
129 0.13
130 0.11
131 0.08
132 0.1
133 0.1
134 0.09
135 0.1
136 0.1
137 0.16
138 0.21
139 0.24
140 0.28
141 0.33
142 0.37
143 0.39
144 0.41
145 0.4
146 0.4
147 0.38
148 0.38
149 0.39
150 0.38
151 0.41
152 0.45
153 0.47
154 0.48
155 0.56
156 0.61
157 0.66
158 0.73
159 0.79
160 0.82
161 0.83
162 0.84
163 0.83
164 0.76
165 0.7
166 0.61
167 0.5
168 0.46
169 0.4
170 0.35
171 0.28
172 0.26
173 0.26
174 0.29
175 0.33
176 0.36
177 0.4
178 0.44
179 0.46
180 0.52
181 0.56
182 0.6