Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G2DVW4

Protein Details
Accession A0A0G2DVW4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
152-176QKKEGAPMPSSKKSKKKKEEAGEAAHydrophilic
NLS Segment(s)
PositionSequence
157-170APMPSSKKSKKKKE
Subcellular Location(s) cyto_nucl 13, nucl 12.5, cyto 12.5
Family & Domain DBs
Amino Acid Sequences MSADTVPLSKVDSAVEEGGTLDDSKIKHRRKSSSAPGVNNILDLEKEGVELQIAPETQKLNWKLNTSPATLEEWKDALKKPLVLPMVKKIDLHFPLGLEVTARNLKGVTIKDALDAIYKQFKKKADDELDNPVLAGFEWDREECYTRFIVHQKKEGAPMPSSKKSKKKKEEAGEAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.12
4 0.12
5 0.12
6 0.12
7 0.1
8 0.07
9 0.1
10 0.1
11 0.19
12 0.28
13 0.35
14 0.42
15 0.49
16 0.57
17 0.62
18 0.72
19 0.74
20 0.76
21 0.76
22 0.72
23 0.68
24 0.64
25 0.55
26 0.46
27 0.35
28 0.25
29 0.17
30 0.14
31 0.12
32 0.08
33 0.08
34 0.08
35 0.07
36 0.07
37 0.07
38 0.06
39 0.07
40 0.08
41 0.08
42 0.09
43 0.1
44 0.11
45 0.18
46 0.21
47 0.24
48 0.27
49 0.29
50 0.29
51 0.35
52 0.38
53 0.32
54 0.29
55 0.25
56 0.27
57 0.25
58 0.25
59 0.19
60 0.16
61 0.16
62 0.17
63 0.17
64 0.15
65 0.16
66 0.17
67 0.16
68 0.21
69 0.22
70 0.21
71 0.22
72 0.26
73 0.29
74 0.27
75 0.27
76 0.23
77 0.27
78 0.27
79 0.28
80 0.21
81 0.16
82 0.16
83 0.16
84 0.15
85 0.09
86 0.07
87 0.08
88 0.09
89 0.09
90 0.08
91 0.08
92 0.09
93 0.12
94 0.13
95 0.14
96 0.15
97 0.15
98 0.15
99 0.15
100 0.15
101 0.13
102 0.13
103 0.11
104 0.18
105 0.19
106 0.21
107 0.25
108 0.29
109 0.32
110 0.35
111 0.43
112 0.42
113 0.47
114 0.48
115 0.52
116 0.5
117 0.44
118 0.41
119 0.31
120 0.23
121 0.17
122 0.16
123 0.07
124 0.07
125 0.1
126 0.1
127 0.12
128 0.14
129 0.18
130 0.16
131 0.19
132 0.19
133 0.18
134 0.23
135 0.3
136 0.37
137 0.39
138 0.46
139 0.48
140 0.49
141 0.54
142 0.54
143 0.5
144 0.44
145 0.47
146 0.49
147 0.53
148 0.58
149 0.61
150 0.66
151 0.73
152 0.81
153 0.83
154 0.86
155 0.87
156 0.9