Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8BFH3

Protein Details
Accession A0A1S8BFH3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-39HRPAKRIRQACEPCRRKKSRCPGERPSCSHCBasic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSSVPPPDHRPAKRIRQACEPCRRKKSRCPGERPSCSHCSRLAQTCYYASDHPAAADHQHSTADSTDANRERHGSFAENVDAAGPCVPLSHLHSSHCMDCFDPEHKKRGRPRIYDVSINKPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.66
3 0.67
4 0.74
5 0.77
6 0.79
7 0.77
8 0.78
9 0.83
10 0.87
11 0.83
12 0.84
13 0.85
14 0.85
15 0.86
16 0.85
17 0.85
18 0.87
19 0.88
20 0.84
21 0.79
22 0.76
23 0.68
24 0.61
25 0.53
26 0.48
27 0.44
28 0.45
29 0.41
30 0.35
31 0.34
32 0.33
33 0.32
34 0.28
35 0.24
36 0.18
37 0.16
38 0.14
39 0.12
40 0.12
41 0.11
42 0.1
43 0.1
44 0.09
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.07
52 0.08
53 0.13
54 0.17
55 0.18
56 0.17
57 0.19
58 0.19
59 0.2
60 0.21
61 0.17
62 0.14
63 0.16
64 0.16
65 0.13
66 0.13
67 0.12
68 0.11
69 0.09
70 0.08
71 0.06
72 0.05
73 0.05
74 0.06
75 0.07
76 0.12
77 0.18
78 0.19
79 0.2
80 0.25
81 0.27
82 0.29
83 0.29
84 0.25
85 0.2
86 0.21
87 0.23
88 0.25
89 0.32
90 0.34
91 0.41
92 0.46
93 0.54
94 0.61
95 0.68
96 0.72
97 0.69
98 0.75
99 0.77
100 0.77
101 0.78
102 0.74