Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8B7L4

Protein Details
Accession A0A1S8B7L4   
Localization Confidence High
Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
82-106IKECLDKKQAKLKKKKEAKEAKEAABasic
147-172GDAEKAPAKKKKKDEPKAKVPKPKGPBasic
NLS Segment(s)
PositionSequence
88-115KKQAKLKKKKEAKEAKEAAIRREKGIED
117-171DDGPPKNARKSSKAAFDGEGAKKSKKRKADGDAEKAPAKKKKKDEPKAKVPKPKG
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013243  SCA7_dom  
IPR037804  SGF73  
Gene Ontology GO:0000124  C:SAGA complex  
Pfam View protein in Pfam  
PF08313  SCA7  
PROSITE View protein in PROSITE  
PS51505  SCA7  
Amino Acid Sequences FKLKRSNVKQTQPGNWKESEITDSAGKKIDPPSAPSSPLVNQLDEKTTAAFPTNRPLDDQLDTVQCRHCRRPVLRTAAKDHIKECLDKKQAKLKKKKEAKEAKEAAIRREKGIEDDDDGPPKNARKSSKAAFDGEGAKKSKKRKADGDAEKAPAKKKKKDEPKAKVPKPKGPVDVEKQCGVLLPNGSMCARSLTCKSHSMGAKRAVPGRSLPYDMLLAQYQKKNQAKQQRAAIDANAPLADDFDNHGPIDSDEEKDAIMAAVARSRPAPLVSRPLVSMQSKYRNIRIKEMLQSAMGGTRGAGLFSTGLPPAHHHPPHSAATMDGTTSMGAPRAPTTNFLSGIFGSADQSSMFAGFMGGAAGGDGMGVDGAGAGATLAARRQASIGGHGPRQILPGQLPGPPSRKQSISGVGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.66
3 0.59
4 0.52
5 0.46
6 0.41
7 0.32
8 0.28
9 0.28
10 0.28
11 0.27
12 0.28
13 0.26
14 0.26
15 0.29
16 0.34
17 0.3
18 0.35
19 0.4
20 0.41
21 0.43
22 0.41
23 0.4
24 0.35
25 0.41
26 0.38
27 0.32
28 0.31
29 0.31
30 0.33
31 0.31
32 0.29
33 0.23
34 0.21
35 0.2
36 0.22
37 0.22
38 0.2
39 0.29
40 0.32
41 0.3
42 0.33
43 0.35
44 0.35
45 0.34
46 0.34
47 0.29
48 0.31
49 0.31
50 0.31
51 0.34
52 0.35
53 0.39
54 0.44
55 0.46
56 0.49
57 0.55
58 0.62
59 0.65
60 0.7
61 0.7
62 0.7
63 0.71
64 0.7
65 0.7
66 0.63
67 0.54
68 0.51
69 0.46
70 0.46
71 0.42
72 0.43
73 0.46
74 0.47
75 0.52
76 0.55
77 0.6
78 0.66
79 0.73
80 0.73
81 0.75
82 0.81
83 0.84
84 0.84
85 0.88
86 0.84
87 0.84
88 0.8
89 0.74
90 0.71
91 0.65
92 0.61
93 0.6
94 0.54
95 0.44
96 0.42
97 0.37
98 0.33
99 0.34
100 0.29
101 0.23
102 0.25
103 0.26
104 0.26
105 0.26
106 0.24
107 0.24
108 0.25
109 0.27
110 0.29
111 0.31
112 0.33
113 0.4
114 0.44
115 0.5
116 0.5
117 0.48
118 0.43
119 0.42
120 0.43
121 0.39
122 0.38
123 0.32
124 0.33
125 0.35
126 0.42
127 0.45
128 0.46
129 0.51
130 0.54
131 0.6
132 0.67
133 0.71
134 0.72
135 0.7
136 0.66
137 0.62
138 0.56
139 0.53
140 0.5
141 0.48
142 0.48
143 0.52
144 0.59
145 0.66
146 0.75
147 0.8
148 0.82
149 0.86
150 0.89
151 0.88
152 0.87
153 0.82
154 0.79
155 0.74
156 0.7
157 0.64
158 0.59
159 0.58
160 0.56
161 0.57
162 0.52
163 0.46
164 0.4
165 0.34
166 0.3
167 0.24
168 0.18
169 0.12
170 0.1
171 0.09
172 0.1
173 0.1
174 0.09
175 0.09
176 0.09
177 0.08
178 0.1
179 0.12
180 0.15
181 0.18
182 0.2
183 0.21
184 0.25
185 0.28
186 0.29
187 0.33
188 0.34
189 0.35
190 0.34
191 0.38
192 0.33
193 0.3
194 0.29
195 0.27
196 0.23
197 0.21
198 0.19
199 0.15
200 0.15
201 0.14
202 0.14
203 0.11
204 0.11
205 0.13
206 0.15
207 0.16
208 0.24
209 0.28
210 0.3
211 0.36
212 0.45
213 0.48
214 0.51
215 0.57
216 0.51
217 0.51
218 0.49
219 0.43
220 0.35
221 0.29
222 0.24
223 0.16
224 0.13
225 0.09
226 0.08
227 0.08
228 0.06
229 0.07
230 0.07
231 0.08
232 0.08
233 0.09
234 0.08
235 0.08
236 0.13
237 0.12
238 0.12
239 0.11
240 0.12
241 0.11
242 0.11
243 0.11
244 0.06
245 0.05
246 0.04
247 0.04
248 0.07
249 0.07
250 0.08
251 0.08
252 0.09
253 0.1
254 0.11
255 0.14
256 0.14
257 0.22
258 0.23
259 0.24
260 0.24
261 0.25
262 0.28
263 0.26
264 0.27
265 0.26
266 0.33
267 0.38
268 0.41
269 0.46
270 0.5
271 0.51
272 0.55
273 0.55
274 0.51
275 0.52
276 0.52
277 0.45
278 0.37
279 0.35
280 0.28
281 0.23
282 0.18
283 0.11
284 0.08
285 0.08
286 0.08
287 0.08
288 0.07
289 0.06
290 0.07
291 0.07
292 0.09
293 0.08
294 0.08
295 0.09
296 0.12
297 0.16
298 0.25
299 0.26
300 0.26
301 0.29
302 0.34
303 0.36
304 0.35
305 0.31
306 0.22
307 0.23
308 0.22
309 0.18
310 0.14
311 0.11
312 0.09
313 0.09
314 0.09
315 0.07
316 0.07
317 0.08
318 0.1
319 0.13
320 0.14
321 0.17
322 0.21
323 0.25
324 0.26
325 0.25
326 0.25
327 0.22
328 0.23
329 0.2
330 0.15
331 0.12
332 0.11
333 0.11
334 0.08
335 0.09
336 0.08
337 0.07
338 0.07
339 0.05
340 0.05
341 0.05
342 0.05
343 0.05
344 0.04
345 0.04
346 0.04
347 0.03
348 0.03
349 0.03
350 0.03
351 0.02
352 0.02
353 0.02
354 0.02
355 0.02
356 0.02
357 0.02
358 0.02
359 0.02
360 0.02
361 0.03
362 0.04
363 0.05
364 0.08
365 0.09
366 0.09
367 0.1
368 0.14
369 0.15
370 0.2
371 0.27
372 0.29
373 0.31
374 0.34
375 0.35
376 0.33
377 0.34
378 0.3
379 0.26
380 0.23
381 0.27
382 0.26
383 0.27
384 0.29
385 0.33
386 0.36
387 0.38
388 0.42
389 0.42
390 0.42
391 0.43
392 0.46