Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8BGG5

Protein Details
Accession A0A1S8BGG5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
185-205FYGKRYRSWWHRRNLLEKLRVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 4, vacu 4, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAVAFVVAQSYIMAQLFSAPPYLLSASGVGYLSLGPFAGGLLGALFAGAAGDPLIAWAAARNGGVYEPEYRLLLAAPGLLMGAGLVLFGHLAQVRASYYATAAAHGVDVFGILCVAVAAGAYGIDAYRDMSSEVFIVGMVFKNFVFYGFSYFVNGWTARAGPARVFYVMGGVGFALVLSTPLLFFYGKRYRSWWHRRNLLEKLRVKTHAEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.09
3 0.1
4 0.1
5 0.11
6 0.1
7 0.1
8 0.12
9 0.13
10 0.1
11 0.1
12 0.1
13 0.1
14 0.11
15 0.11
16 0.08
17 0.08
18 0.08
19 0.07
20 0.06
21 0.06
22 0.04
23 0.04
24 0.04
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.04
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.08
53 0.1
54 0.1
55 0.11
56 0.11
57 0.11
58 0.1
59 0.1
60 0.09
61 0.06
62 0.05
63 0.04
64 0.04
65 0.04
66 0.03
67 0.03
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.03
77 0.03
78 0.04
79 0.04
80 0.05
81 0.05
82 0.06
83 0.06
84 0.05
85 0.05
86 0.07
87 0.07
88 0.07
89 0.07
90 0.06
91 0.06
92 0.06
93 0.06
94 0.03
95 0.03
96 0.03
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.04
114 0.04
115 0.04
116 0.05
117 0.05
118 0.06
119 0.06
120 0.06
121 0.05
122 0.05
123 0.04
124 0.05
125 0.06
126 0.05
127 0.06
128 0.06
129 0.07
130 0.07
131 0.08
132 0.09
133 0.08
134 0.13
135 0.14
136 0.14
137 0.15
138 0.15
139 0.15
140 0.17
141 0.16
142 0.12
143 0.11
144 0.12
145 0.11
146 0.14
147 0.14
148 0.12
149 0.14
150 0.15
151 0.15
152 0.15
153 0.13
154 0.12
155 0.12
156 0.1
157 0.08
158 0.06
159 0.05
160 0.05
161 0.04
162 0.03
163 0.02
164 0.03
165 0.03
166 0.04
167 0.04
168 0.04
169 0.06
170 0.06
171 0.07
172 0.15
173 0.24
174 0.26
175 0.28
176 0.32
177 0.39
178 0.5
179 0.61
180 0.61
181 0.62
182 0.69
183 0.75
184 0.8
185 0.82
186 0.81
187 0.8
188 0.79
189 0.75
190 0.73
191 0.7