Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4F914

Protein Details
Accession A0A0C4F914    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
24-49GAPSRDFSRHRKPPQKAASQRRPAPSHydrophilic
NLS Segment(s)
PositionSequence
33-46HRKPPQKAASQRRP
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
Amino Acid Sequences MQKKPRPGKMRTVYDTDARVCPVGAPSRDFSRHRKPPQKAASQRRPAPSSSRANRPQGMVFSVGDLPQELQKIGGSELPSAPDSLPAPIPARTARGMGVVFNVNELPQELKELRAQGSKANPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.6
3 0.52
4 0.44
5 0.35
6 0.31
7 0.23
8 0.21
9 0.2
10 0.23
11 0.22
12 0.23
13 0.25
14 0.3
15 0.36
16 0.39
17 0.42
18 0.46
19 0.55
20 0.62
21 0.69
22 0.7
23 0.75
24 0.8
25 0.83
26 0.83
27 0.83
28 0.83
29 0.82
30 0.82
31 0.78
32 0.71
33 0.62
34 0.58
35 0.54
36 0.53
37 0.49
38 0.52
39 0.52
40 0.55
41 0.54
42 0.5
43 0.44
44 0.35
45 0.31
46 0.24
47 0.18
48 0.14
49 0.13
50 0.11
51 0.09
52 0.08
53 0.07
54 0.07
55 0.07
56 0.06
57 0.06
58 0.06
59 0.07
60 0.08
61 0.09
62 0.09
63 0.09
64 0.1
65 0.11
66 0.11
67 0.11
68 0.11
69 0.11
70 0.1
71 0.11
72 0.11
73 0.11
74 0.13
75 0.13
76 0.15
77 0.15
78 0.17
79 0.17
80 0.17
81 0.16
82 0.17
83 0.16
84 0.14
85 0.16
86 0.15
87 0.14
88 0.14
89 0.14
90 0.11
91 0.11
92 0.12
93 0.11
94 0.09
95 0.14
96 0.14
97 0.16
98 0.2
99 0.22
100 0.25
101 0.28
102 0.28
103 0.29