Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4F393

Protein Details
Accession A0A0C4F393   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
163-230GWNPYTKRKHIKVLENNKKNIKVNKETQKKKPYKIPKINRSNPKASGSKPYERKPKSGSNKWKETFKMHydrophilic
NLS Segment(s)
PositionSequence
170-224RKHIKVLENNKKNIKVNKETQKKKPYKIPKINRSNPKASGSKPYERKPKSGSNKW
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MDSKANFTLSHHWKHHWNPAGFEFTPLWIPLDTYHTQETTAPGYPTRQNHQTIVRPEGHGIETARRLEKTTHRILPPPKEVEEGEQPEEDKLKVITKEPPRVLNKAQEDAIAIFKATKAAYLNAKNYDEMDLLKSYLKQAILLFRVVQKFLPWKEILAKQSDGWNPYTKRKHIKVLENNKKNIKVNKETQKKKPYKIPKINRSNPKASGSKPYERKPKSGSNKWKETFKMARVLMEVKDAIME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.63
3 0.63
4 0.58
5 0.55
6 0.55
7 0.59
8 0.5
9 0.47
10 0.38
11 0.3
12 0.29
13 0.24
14 0.21
15 0.14
16 0.14
17 0.13
18 0.19
19 0.18
20 0.2
21 0.22
22 0.2
23 0.21
24 0.22
25 0.23
26 0.2
27 0.22
28 0.19
29 0.18
30 0.22
31 0.27
32 0.3
33 0.34
34 0.37
35 0.37
36 0.41
37 0.47
38 0.5
39 0.49
40 0.5
41 0.47
42 0.42
43 0.4
44 0.37
45 0.31
46 0.26
47 0.23
48 0.21
49 0.21
50 0.23
51 0.25
52 0.23
53 0.24
54 0.26
55 0.33
56 0.36
57 0.4
58 0.44
59 0.43
60 0.5
61 0.55
62 0.58
63 0.57
64 0.53
65 0.47
66 0.43
67 0.41
68 0.38
69 0.39
70 0.35
71 0.3
72 0.26
73 0.25
74 0.23
75 0.24
76 0.2
77 0.13
78 0.1
79 0.12
80 0.13
81 0.14
82 0.22
83 0.28
84 0.36
85 0.37
86 0.44
87 0.44
88 0.47
89 0.48
90 0.48
91 0.43
92 0.38
93 0.36
94 0.28
95 0.25
96 0.22
97 0.2
98 0.12
99 0.09
100 0.07
101 0.07
102 0.08
103 0.07
104 0.07
105 0.07
106 0.09
107 0.14
108 0.17
109 0.19
110 0.21
111 0.22
112 0.21
113 0.21
114 0.2
115 0.15
116 0.13
117 0.12
118 0.1
119 0.1
120 0.1
121 0.1
122 0.09
123 0.11
124 0.1
125 0.1
126 0.11
127 0.14
128 0.15
129 0.15
130 0.15
131 0.17
132 0.18
133 0.17
134 0.16
135 0.14
136 0.19
137 0.19
138 0.23
139 0.19
140 0.2
141 0.25
142 0.29
143 0.3
144 0.28
145 0.28
146 0.24
147 0.3
148 0.31
149 0.28
150 0.26
151 0.31
152 0.3
153 0.39
154 0.45
155 0.45
156 0.52
157 0.55
158 0.62
159 0.62
160 0.7
161 0.71
162 0.76
163 0.8
164 0.79
165 0.81
166 0.77
167 0.75
168 0.71
169 0.67
170 0.64
171 0.61
172 0.63
173 0.67
174 0.72
175 0.75
176 0.78
177 0.82
178 0.82
179 0.81
180 0.82
181 0.82
182 0.83
183 0.86
184 0.87
185 0.87
186 0.9
187 0.92
188 0.92
189 0.89
190 0.84
191 0.78
192 0.74
193 0.69
194 0.6
195 0.61
196 0.57
197 0.59
198 0.61
199 0.65
200 0.69
201 0.68
202 0.72
203 0.68
204 0.72
205 0.73
206 0.75
207 0.78
208 0.77
209 0.84
210 0.81
211 0.82
212 0.74
213 0.73
214 0.71
215 0.64
216 0.64
217 0.54
218 0.52
219 0.48
220 0.48
221 0.39
222 0.35
223 0.3