Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8B356

Protein Details
Accession A0A1S8B356    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
191-231AEANGKKGRGRPKKAENGEKKQAAKAKPKKEPKKAATETGEBasic
NLS Segment(s)
PositionSequence
156-169KRKAKETNGEEKKK
193-240ANGKKGRGRPKKAENGEKKQAAKAKPKKEPKKAATETGEPRRSGRNKS
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 6.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000637  HMGI/Y_DNA-bd_CS  
IPR021331  Hva1_TUDOR  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences MSELQKGDEVSWKWGGGAPGGTVAEVAKEGEIAIESNKGNTIKKNADPENPAVHIERPGNDVVKKASELELESKANGSEEKAEKKDDDKDNKEEEKKDEDKENKAAEKEATNGEKKAEGDKDESKGEENKEPAKDEKEEEKTSEKKETDEAQPGDKRKAKETNGEEKKKSEEKTDDKQDDEPPAKQQKTEAEANGKKGRGRPKKAENGEKKQAAKAKPKKEPKKAATETGEPRRSGRNKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.2
4 0.19
5 0.15
6 0.15
7 0.15
8 0.14
9 0.12
10 0.11
11 0.09
12 0.08
13 0.08
14 0.05
15 0.05
16 0.05
17 0.05
18 0.06
19 0.06
20 0.07
21 0.1
22 0.1
23 0.11
24 0.15
25 0.16
26 0.18
27 0.22
28 0.28
29 0.3
30 0.35
31 0.44
32 0.45
33 0.49
34 0.51
35 0.51
36 0.49
37 0.45
38 0.41
39 0.34
40 0.31
41 0.29
42 0.26
43 0.23
44 0.21
45 0.21
46 0.23
47 0.22
48 0.22
49 0.2
50 0.2
51 0.2
52 0.18
53 0.18
54 0.16
55 0.17
56 0.18
57 0.2
58 0.19
59 0.18
60 0.17
61 0.16
62 0.15
63 0.13
64 0.11
65 0.13
66 0.17
67 0.22
68 0.23
69 0.25
70 0.25
71 0.28
72 0.36
73 0.38
74 0.43
75 0.43
76 0.47
77 0.52
78 0.58
79 0.59
80 0.54
81 0.49
82 0.47
83 0.45
84 0.43
85 0.44
86 0.42
87 0.42
88 0.44
89 0.44
90 0.39
91 0.36
92 0.35
93 0.28
94 0.24
95 0.22
96 0.21
97 0.2
98 0.19
99 0.19
100 0.18
101 0.19
102 0.18
103 0.2
104 0.18
105 0.16
106 0.19
107 0.21
108 0.22
109 0.21
110 0.21
111 0.19
112 0.21
113 0.22
114 0.2
115 0.21
116 0.22
117 0.23
118 0.25
119 0.25
120 0.25
121 0.24
122 0.24
123 0.29
124 0.31
125 0.31
126 0.31
127 0.35
128 0.36
129 0.37
130 0.41
131 0.34
132 0.29
133 0.31
134 0.33
135 0.31
136 0.35
137 0.34
138 0.33
139 0.37
140 0.39
141 0.43
142 0.43
143 0.41
144 0.39
145 0.46
146 0.43
147 0.48
148 0.53
149 0.56
150 0.62
151 0.67
152 0.63
153 0.56
154 0.6
155 0.57
156 0.51
157 0.48
158 0.46
159 0.47
160 0.54
161 0.63
162 0.59
163 0.55
164 0.57
165 0.53
166 0.52
167 0.48
168 0.4
169 0.38
170 0.45
171 0.43
172 0.4
173 0.4
174 0.38
175 0.4
176 0.44
177 0.4
178 0.41
179 0.43
180 0.5
181 0.52
182 0.48
183 0.46
184 0.47
185 0.54
186 0.54
187 0.6
188 0.62
189 0.67
190 0.76
191 0.83
192 0.87
193 0.87
194 0.86
195 0.87
196 0.84
197 0.76
198 0.72
199 0.7
200 0.67
201 0.67
202 0.68
203 0.68
204 0.72
205 0.8
206 0.84
207 0.88
208 0.91
209 0.87
210 0.89
211 0.84
212 0.83
213 0.78
214 0.76
215 0.75
216 0.75
217 0.73
218 0.63
219 0.59
220 0.61
221 0.6