Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8BMP0

Protein Details
Accession A0A1S8BMP0    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
3-34DDSSRPSKRTRQACEGCRRKKTRCPGEQPACSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MADDSSRPSKRTRQACEGCRRKKTRCPGEQPACSLCVRLGQVCSYNEGSNNGSRVQDSDQSIVRACARTLMSLHSFYQITGRAPAEPREQDGPDAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.77
3 0.83
4 0.84
5 0.84
6 0.85
7 0.84
8 0.8
9 0.8
10 0.82
11 0.81
12 0.81
13 0.81
14 0.81
15 0.83
16 0.8
17 0.75
18 0.65
19 0.57
20 0.47
21 0.38
22 0.27
23 0.2
24 0.17
25 0.14
26 0.13
27 0.12
28 0.16
29 0.15
30 0.18
31 0.17
32 0.16
33 0.15
34 0.16
35 0.17
36 0.14
37 0.15
38 0.13
39 0.12
40 0.12
41 0.13
42 0.13
43 0.16
44 0.16
45 0.17
46 0.17
47 0.18
48 0.18
49 0.18
50 0.18
51 0.15
52 0.13
53 0.15
54 0.14
55 0.15
56 0.15
57 0.18
58 0.19
59 0.21
60 0.21
61 0.2
62 0.2
63 0.18
64 0.21
65 0.19
66 0.18
67 0.19
68 0.2
69 0.2
70 0.23
71 0.27
72 0.31
73 0.31
74 0.34
75 0.36
76 0.36