Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8BK47

Protein Details
Accession A0A1S8BK47    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
238-260GEKPEKKENQAKNKQESQKRKAEBasic
NLS Segment(s)
PositionSequence
257-257R
Subcellular Location(s) nucl 14, cyto_nucl 10.833, mito_nucl 9.833, cyto 6.5, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016195  Pol/histidinol_Pase-like  
IPR002738  RNase_P_p30  
Gene Ontology GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01876  RNase_P_p30  
Amino Acid Sequences MFYDLNVPWSAKDPELPRTIAFLADLGYNVVALSHTLSGKLPADLTSPILDPLPFAVPKHVRILRRCTLVLADTAQNHRINNLAPAYDILAVRPVDEKTLQQACQSLDCDIISIDMTQRLGFFFKFKMLSQAIERGVKFEICYAPGIMAKDSSARRNLIQNTTQLIRASRGRGLIISSEAKSAVGCRAPWDVINLAAVWGLGQERGHEAVSKEARAAVVSAQMKRTSFRGVIDVVYGGEKPEKKENQAKNKQESQKRKAEGMAKSSENVSEQGKAPSKSQLKKQATRARVEGSKPAQPGNDKKTVAAEPMDTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.38
4 0.33
5 0.35
6 0.34
7 0.28
8 0.25
9 0.18
10 0.14
11 0.13
12 0.12
13 0.09
14 0.08
15 0.07
16 0.07
17 0.06
18 0.05
19 0.05
20 0.07
21 0.08
22 0.09
23 0.1
24 0.1
25 0.14
26 0.15
27 0.15
28 0.14
29 0.12
30 0.14
31 0.14
32 0.16
33 0.15
34 0.14
35 0.14
36 0.14
37 0.13
38 0.11
39 0.12
40 0.14
41 0.13
42 0.13
43 0.21
44 0.23
45 0.26
46 0.34
47 0.38
48 0.4
49 0.46
50 0.54
51 0.52
52 0.54
53 0.52
54 0.45
55 0.41
56 0.36
57 0.32
58 0.26
59 0.22
60 0.2
61 0.23
62 0.26
63 0.26
64 0.24
65 0.23
66 0.22
67 0.19
68 0.21
69 0.19
70 0.15
71 0.13
72 0.14
73 0.15
74 0.15
75 0.14
76 0.1
77 0.13
78 0.12
79 0.13
80 0.14
81 0.13
82 0.13
83 0.14
84 0.14
85 0.17
86 0.22
87 0.21
88 0.21
89 0.23
90 0.22
91 0.24
92 0.24
93 0.18
94 0.15
95 0.14
96 0.13
97 0.1
98 0.1
99 0.07
100 0.06
101 0.06
102 0.07
103 0.07
104 0.07
105 0.07
106 0.07
107 0.08
108 0.08
109 0.09
110 0.09
111 0.11
112 0.13
113 0.13
114 0.18
115 0.17
116 0.19
117 0.19
118 0.23
119 0.23
120 0.24
121 0.24
122 0.2
123 0.2
124 0.18
125 0.16
126 0.14
127 0.12
128 0.1
129 0.11
130 0.09
131 0.09
132 0.11
133 0.11
134 0.09
135 0.08
136 0.08
137 0.11
138 0.13
139 0.15
140 0.16
141 0.16
142 0.17
143 0.23
144 0.26
145 0.25
146 0.26
147 0.26
148 0.26
149 0.26
150 0.26
151 0.21
152 0.19
153 0.17
154 0.17
155 0.17
156 0.16
157 0.16
158 0.15
159 0.14
160 0.14
161 0.13
162 0.13
163 0.13
164 0.12
165 0.11
166 0.11
167 0.11
168 0.1
169 0.1
170 0.1
171 0.09
172 0.09
173 0.1
174 0.12
175 0.13
176 0.13
177 0.14
178 0.13
179 0.11
180 0.12
181 0.1
182 0.08
183 0.07
184 0.07
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.05
191 0.06
192 0.08
193 0.08
194 0.1
195 0.1
196 0.17
197 0.19
198 0.19
199 0.18
200 0.17
201 0.17
202 0.15
203 0.15
204 0.08
205 0.13
206 0.16
207 0.18
208 0.19
209 0.21
210 0.21
211 0.22
212 0.24
213 0.21
214 0.19
215 0.19
216 0.2
217 0.19
218 0.19
219 0.18
220 0.17
221 0.13
222 0.12
223 0.11
224 0.09
225 0.13
226 0.14
227 0.16
228 0.25
229 0.28
230 0.34
231 0.44
232 0.53
233 0.6
234 0.68
235 0.74
236 0.73
237 0.8
238 0.82
239 0.83
240 0.84
241 0.8
242 0.79
243 0.74
244 0.69
245 0.65
246 0.64
247 0.59
248 0.55
249 0.53
250 0.45
251 0.43
252 0.4
253 0.35
254 0.29
255 0.25
256 0.21
257 0.18
258 0.18
259 0.25
260 0.3
261 0.3
262 0.3
263 0.38
264 0.45
265 0.48
266 0.56
267 0.6
268 0.63
269 0.69
270 0.79
271 0.79
272 0.77
273 0.76
274 0.72
275 0.68
276 0.65
277 0.6
278 0.59
279 0.54
280 0.53
281 0.49
282 0.47
283 0.45
284 0.47
285 0.53
286 0.51
287 0.55
288 0.5
289 0.49
290 0.51
291 0.48
292 0.44
293 0.37